If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: QSICNCLK
Peptide within the protein Pru-du-3:
MASSGQLLKLVCLVAVMCCMAVGGPKAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKTIK
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide QSICNCLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Prunus persica | Peach | XP_007206148 AAM22767 |
3760 |
| Prunus mume | Japanese apricot | XP_008244918 XP_008244911 |
102107 |
| Nicotiana tabacum | Common tobacco | XP_016433135 |
4097 |
| Prunus dulcis | Almond | AGR27933 XP_007206148 ACN11576 |
3755 |
| Prunus dulcis x Prunus persica | Prunus dulcis x prunus persica | XP_007206148 |
472390 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.