Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DFDQPGTLAPTGLFLGGTK
Peptide within the protein Pru-du-4:
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide DFDQPGTLAPTGLFLGGTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Citrus sinensis | Sweet orange | P84177 P84177 |
2711 |
| Cucumis melo | Muskmelon | CAD92666 CAD92666 |
3656 |
| Fragaria vesca subsp. vesca | Fragaria vesca subsp. vesca | XP_004291152 XP_004291152 |
101020 |
| Malus domestica | Apple | CAT99619 Q9XF42 CAK93757 CAK93753 CAD46561 CAT99619 Q9XF42 CAK93757 CAK93753 CAD46561 |
3750 |
| Prunus dulcis | Almond | AGR27934 XP_008220131 AGR27934 XP_008220131 |
3755 |
| Prunus dulcis x Prunus persica | Prunus dulcis x prunus persica | XP_008220131 XP_008220131 |
472390 |
| Prunus mume | Japanese apricot | XP_008220131 XP_008220131 |
102107 |
| Prunus persica | Peach | CAD37201 XP_007223783 CAD37201 XP_007223783 |
3760 |
| Pyrus x bretschneideri | Pyrus x bretschneideri | XP_009350242 XP_009367418 XP_009350242 XP_009367418 |
225117 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.