Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL
MSWQQYVDDHLMCDIDGNRLTAAAILGQDGSVWSQSATFPAFKPEEIAAILKDFDQPGTLAPTGLFLGGTKYMVIQGEAGAVIRGKKGSGGITVKKTNQALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL
None.
Species containing the peptide TNQALIIGIYDEPLTPGQCNMIVER are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Citrus sinensis | Sweet orange | P84177 P84177 |
2711 |
| Cucumis melo | Muskmelon | CAD92666 CAD92666 |
3656 |
| Manihot esculenta | Cassava | OAY26767 OAY26767 |
3983 |
| Prunus avium | Sweet cherry | Q9XF39 Q9XF39 |
42229 |
| Prunus dulcis | Almond | XP_008220131 XP_008220131 |
3755 |
| Prunus dulcis x Prunus persica | Prunus dulcis x prunus persica | XP_008220131 XP_008220131 |
472390 |
| Prunus mume | Japanese apricot | XP_008220131 XP_008220131 |
102107 |
| Prunus persica | Peach | CAD37201 XP_007223783 CAD37201 XP_007223783 |
3760 |
| Theobroma cacao | Cacao | XP_007012196 EOY29816 XP_007012196 EOY29816 |
3641 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.