Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDITELIASGREKLASVPSGGGAVAVAAPGAGAGAAAPAAAEPKKEEKVEEKEDTDDDMGFSLFD
Species containing the peptide DITELIASGR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Amborella trichopoda | Amborella trichopoda | XP_006858566 |
13333 |
| Ananas comosus | Pineapple | OAY75567 |
4615 |
| Anthurium amnicola | Anthurium amnicola | JAT56687 JAT41307 |
1678845 |
| Camellia sinensis | Camellia sinensis | AEC11018 |
4442 |
| Capsicum annuum | Capsicum annuum | XP_016547584 |
4072 |
| Citrus clementina | Citrus clementina | XP_006424296 XP_006430260 |
85681 |
| Citrus sinensis | Sweet orange | KDO51333 XP_006471373 XP_006481819 KDO61085 |
2711 |
| Cleome hassleriana | Cleome hassleriana | XP_010520675 XP_010541287 |
28532 |
| Cucumis sativus | Cucumber | XP_004150488 XP_004145795 |
3659 |
| Cynara cardunculus var. scolymus | Cynara cardunculus var. scolymus | KVI09247 |
59895 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | XP_017248547 XP_017232344 XP_017237237 XP_017227747 KZM99264 KZN03424 KZM80777 |
79200 |
| Elaeis guineensis | African oil palm | XP_010912250 XP_010926364 |
51953 |
| Eucalyptus grandis | Eucalyptus grandis | KCW50805 XP_010031491 |
71139 |
| Fragaria vesca subsp. vesca | Fragaria vesca subsp. vesca | XP_011467330 XP_004303010 |
101020 |
| Genlisea aurea | Genlisea aurea | EPS73855 EPS74099 |
192259 |
| Gossypium arboreum | Gossypium arboreum | XP_016719392 XP_017611301 XP_017621108 XP_017620362 XP_016744021 XP_017603277 |
29729 |
| Gossypium hirsutum | Upland cotton | XP_016711759 XP_016719392 XP_016669512 XP_016719390 XP_016733290 XP_016753326 XP_016720029 XP_016714875 XP_012472831 XP_016744021 |
3635 |
| Gossypium raimondii | Gossypium raimondii | XP_012485823 XP_012468193 XP_012472833 XP_012472831 KJB06824 XP_012476644 KJB21688 |
29730 |
| Hyacinthus orientalis | Hyacinthus orientalis | AAT08664 AAS20966 |
82025 |
| Malus domestica | Apple | XP_008342938 XP_008391761 XP_008355226 XP_008351356 XP_008348607 XP_008360542 XP_017184888 XP_017180316 XP_008358569 |
3750 |
| Mimulus guttatus | Spotted monkey flower | XP_012838542 XP_012839790 |
4155 |
| Morus notabilis | Morus notabilis | XP_010093218 |
981085 |
| Nelumbo nucifera | Nelumbo nucifera | XP_010242613 XP_010244112 XP_010275438 XP_010241325 |
4432 |
| Oryza brachyantha | Malo sina | XP_006643860 |
4533 |
| Parthenium argentatum | Parthenium argentatum | P41099 |
35935 |
| Phoenix dactylifera | Date palm | XP_008783987 XP_008788306 |
42345 |
| Populus euphratica | Populus euphratica | XP_011044769 |
75702 |
| Populus trichocarpa | Black cottonwood | XP_002313663 XP_006384635 ABK92597 |
3694 |
| Prunus dulcis | Almond | XP_008241270 |
3755 |
| Prunus mume | Japanese apricot | XP_008227500 XP_008241270 XP_016651805 |
102107 |
| Prunus persica | Peach | XP_007202715 |
3760 |
| Pyrus x bretschneideri | Pyrus x bretschneideri | XP_009366640 XP_009364278 XP_009374748 |
225117 |
| Ricinus communis | Castor bean | XP_002534003 XP_002525251 EEF37217 XP_002525250 |
3988 |
| Vitis vinifera | Wine grape | CAN61098 XP_010651712 XP_002273733 XP_002283025 XP_002264645 XP_002266030 |
29760 |
| Zostera marina | Zostera marina | KMZ72899 |
29655 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.