Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AFFVIDQDK
Peptide within the protein Gad-m-1:
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AFFVIDQDK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Macruronus magellanicus | Patagonian grenadier | P86740 P86741 P86740 P86741 |
92050 |
| Gadus morhua | Atlantic cod | CAM56785 AAK63086 CAM56785 AAK63086 |
8049 |
| Astyanax mexicanus | Mexican tetra | XP_007251243 XP_007251243 |
7994 |
| Clupea harengus | Atlantic herring | XP_012694368 XP_012694367 XP_012694366 XP_012694368 XP_012694367 XP_012694366 |
7950 |
| Cyprinus carpio | Common carp | KTF86532 KTF75949 KTF86532 KTF75949 |
7962 |
| Danio rerio | Zebrafish | NP_571591 NP_571591 |
7955 |
| Dentex tumifrons | Yellowback seabream | BAK09232 BAK09232 |
119711 |
| Ictalurus punctatus | Channel catfish | NP_001187965 NP_001187965 |
7998 |
| Macruronus novaezelandiae | Blue grenadier | P86742 P86741 P86742 P86741 |
248764 |
| Merluccius australis australis | Merluccius australis australis | P86750 P86750 |
307686 |
| Merluccius australis polylepis | Merluccius australis polylepis | P86750 P86750 |
307685 |
| Merluccius bilinearis | Silver hake | P56503 P86753 1BU3_A P56503 P86753 1BU3_A |
79698 |
| Merluccius capensis | Shallow-water cape hake | P86757 P86757 |
89947 |
| Merluccius gayi | Southern pacific hake | P86758 P86750 P86758 P86750 |
89948 |
| Merluccius hubbsi | Argentine hake | P86750 P86750 |
89949 |
| Merluccius merluccius | European hake | P86757 P86757 |
8063 |
| Merluccius paradoxus | Deep-water cape hake | P86769 P86769 |
89950 |
| Merluccius polli | Benguela hake | P86771 P86771 |
89951 |
| Merluccius productus | North pacific hake | P86775 P86775 |
89952 |
| Merluccius senegalensis | Senegalese hake | P86757 P86757 |
89953 |
| Pygocentrus nattereri | Red-bellied piranha | XP_017561042 XP_017561042 |
42514 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016316782 XP_016316782 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016139622 XP_016126229 XP_016139622 XP_016126229 |
75366 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016389187 XP_016425036 XP_016389187 XP_016425036 |
307959 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.