Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ALSDAETK
Peptide within the protein Gad-m-1:
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Fish | Gad-m-1.0201 | 8049 |
| Fish | Gad-m-1.0202 | 8049 |
| Fish | Seb-m-1.0201 | 34821 |
Species containing the peptide ALSDAETK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Merluccius bilinearis | Silver hake | P86754 P86754 P86754 |
79698 |
| Gadus chalcogrammus | Walleye pollock | Q90YK7 Q90YK7 Q90YK7 |
1042646 |
| Gadus morhua | Atlantic cod | CAM56786 Q90YK9 CAM56786 Q90YK9 CAM56786 Q90YK9 |
8049 |
| Hypsizygus marmoreus | Hypsizygus marmoreus | KYQ42088 KYQ42088 KYQ42088 |
39966 |
| Katsuwonus pelamis | Skipjack tuna | BAF98924 BAF98924 BAF98924 |
8226 |
| Latimeria chalumnae | Coelacanth | XP_005998420 XP_005998420 XP_005998420 |
7897 |
| Maylandia zebra | Zebra mbuna | XP_014264879 XP_014264878 XP_014263921 XP_014263920 XP_014264879 XP_014264878 XP_014263921 XP_014263920 XP_014264879 XP_014264878 XP_014263921 XP_014263920 |
106582 |
| Merluccius australis australis | Merluccius australis australis | P86746 P86746 P86746 |
307686 |
| Merluccius australis polylepis | Merluccius australis polylepis | P86751 P86751 P86751 |
307685 |
| Merluccius capensis | Shallow-water cape hake | P86755 P86755 P86755 |
89947 |
| Merluccius gayi | Southern pacific hake | P86760 P86760 P86760 |
89948 |
| Merluccius hubbsi | Argentine hake | P86763 P86763 P86763 |
89949 |
| Merluccius merluccius | European hake | P86772 P86772 P86772 |
8063 |
| Merluccius paradoxus | Deep-water cape hake | P86770 P86770 P86770 |
89950 |
| Merluccius polli | Benguela hake | P86772 P86772 P86772 |
89951 |
| Merluccius productus | North pacific hake | P86776 P86776 P86776 |
89952 |
| Merluccius senegalensis | Senegalese hake | P86755 P86755 P86755 |
89953 |
| Scomber japonicus | Chub mackerel | P59747 P59747 P59747 |
13676 |
| Scomber scombrus | Atlantic mackerel | CAX32965 CAX32965 CAX32965 |
13677 |
| Sebastes marinus | Ocean perch | CAQ72969 CAQ72969 CAQ72969 |
34821 |
| Trachurus japonicus | Japanese jack mackerel | BAE46762 BAE46762 BAE46762 |
83875 |
| Trichosporon asahii var. asahii CBS 2479 | Trichosporon asahii var. asahii cbs 2479 | XP_014181281 XP_014181281 XP_014181281 |
1186058 |
| Trichosporon asahii var. asahii CBS 8904 | Trichosporon asahii var. asahii cbs 8904 | EKD01045 EKD01045 EKD01045 |
1220162 |
| Xenopus laevis | African clawed frog | XP_018094664 XP_018094664 XP_018094664 |
8355 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.