Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SDFVEEDELK
Peptide within the protein Gad-m-1:
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
References reporting this peptide:
- Carrera, et al. Rapid direct detection of the major fish allergen, parvalbumin, by selected MS/MS ion monitoring mass spectrometry. Journal of Proteomics. 2012
Species Uniqueness
Species containing the peptide SDFVEEDELK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Merluccius capensis | Shallow-water cape hake | P02620 P02620 |
89947 |
| Gadus morhua | Atlantic cod | CAM56786 Q90YK9 CAM56786 Q90YK9 |
8049 |
| Macruronus magellanicus | Patagonian grenadier | P86739 P86739 |
92050 |
| Macruronus novaezelandiae | Blue grenadier | P86739 P86739 |
248764 |
| Merluccius australis australis | Merluccius australis australis | P86749 P86745 P86749 P86745 |
307686 |
| Merluccius australis polylepis | Merluccius australis polylepis | P86749 P86749 |
307685 |
| Merluccius bilinearis | Silver hake | P86752 P86752 |
79698 |
| Merluccius gayi | Southern pacific hake | P86761 P86761 |
89948 |
| Merluccius hubbsi | Argentine hake | P86761 P86761 |
89949 |
| Merluccius merluccius | European hake | P02620 P86765 P02620 P86765 |
8063 |
| Merluccius paradoxus | Deep-water cape hake | P86768 P86768 |
89950 |
| Merluccius polli | Benguela hake | P86761 P86761 |
89951 |
| Merluccius productus | North pacific hake | P86774 P86774 |
89952 |
| Merluccius senegalensis | Senegalese hake | P02620 P02620 |
89953 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.