If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VIDQDASGFIEVEELK
Peptide within the protein Sal-s-1:
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
References reporting this peptide:
- Carrera, et al. Rapid direct detection of the major fish allergen, parvalbumin, by selected MS/MS ion monitoring mass spectrometry. Journal of Proteomics. 2012
- Nakamura R., et al. Comparative study of GH-transgenic and non-transgenic amago salmon (Oncorhynchus masou ishikawae) allergenicity and proteomic analysis of amago salmon allergens. Regulatory Toxicology and Pharmacology. 2009
Species Uniqueness
Species containing the peptide VIDQDASGFIEVEELK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Oncorhynchus kisutch | Coho salmon | CBG76586 |
8019 |
| Oncorhynchus mykiss | Rainbow trout | AGG35867 NP_001182339 CBA35341 CDQ83771 |
8022 |
| Salmo salar | Atlantic salmon | AGG35870 ACH71041 XP_014049624 NP_001117190 CBA35349 XP_014058479 |
8030 |
| Salmo trutta | Brown trout | AGG35877 |
8032 |
| Salvelinus alpinus | Arctic char | AGG35867 |
8036 |
| Salvelinus fontinalis | Brook trout | NP_001182339 |
8038 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.