Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Atlantic%25252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252525252520cod Protein: Gad m 1 | β-Parvalbumin
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 109 amino acids
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
UniProt: Q90YL0 IUIS: Gad m 1Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MAFAGILADADCAAAVK | A | 0 | 0.498 | 0.41988 |
| K | ACEAAESFSYK | A | 0 | 0.431 | 0.61018 |
| K | AFFVIDQDK | S | 0 | 0.475 | 0.4012 |
| K | SGFIEEDELK | L | 1 | 0.436 | 0.60546 |
| K | LFLQVFK | A | 0 | 0.289 | 0.18286 |
| R | ALTDAETK | A | 0 | 0.23 | 0.4154 |
| K | AGDSDGDGAIGVDEWAVLVK | A | 0 | 0.524 | 0.41584 |
| K | AGDSDGDGAIGVEEWAVLVK | A | 0 | 0.546 | 0.39968 |
| ^ | MAFAGILNDADITAALAACK | A | 0 | 0.596 | 0.16676 |
| K | AEGSFDHK | A | 0 | 0.26 | 0.15778 |
| K | VFEIIDQDK | S | 0 | 0.402 | 0.49594 |
| K | SDFVEEDELK | L | 1 | 0.487 | 0.53554 |
| K | LFLQNFSAGAR | A | 1 | 0.597 | 0.47208 |
| R | ALSDAETK | V | 0 | 0.237 | 0.28628 |
| K | AGDSDGDGK | I | 0 | 0.236 | 0.13786 |
| K | IGVDEFGAMIK | A | 0 | 0.467 | 0.45244 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.