Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LFLQVFK
Peptide within the protein Gad-m-1:
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
MAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFIEEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVEEWAVLVKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
MAFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSSADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LFLQVFK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Tolypocladium ophioglossoides CBS 100239 | Tolypocladium ophioglossoides cbs 100239 | KND87213 KND87213 |
1163406 |
| Aplysia californica | California sea hare | XP_005105881 XP_005105881 |
6500 |
| Cynoglossus semilaevis | Tongue sole | XP_008327874 XP_008327874 |
244447 |
| Dictyostelium lacteum | Dictyostelium lacteum | KYR00781 KYR00781 |
361077 |
| Fragaria vesca subsp. vesca | Fragaria vesca subsp. vesca | XP_004292618 XP_004292618 |
101020 |
| Gadus morhua | Atlantic cod | CAM56785 AAK63086 CAM56785 AAK63086 |
8049 |
| Marchantia polymorpha subsp. polymorpha | Marchantia polymorpha subsp. polymorpha | OAE23620 OAE23620 |
1480153 |
| Merlangius merlangus | Whiting | P02621 0308206A 1A75_B P02621 0308206A 1A75_B |
8058 |
| Naegleria gruberi | Naegleria gruberi | XP_002669349 XP_002669349 |
5762 |
| Naegleria gruberi strain NEG-M | Naegleria gruberi strain neg-m | XP_002669349 XP_002669349 |
744533 |
| Pteropus vampyrus | Large flying fox | XP_011378931 XP_011378931 |
132908 |
| Suillus luteus UH-Slu-Lm8-n1 | Suillus luteus uh-slu-lm8-n1 | KIK41327 KIK41327 |
930992 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.