If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Atlantic-herring Protein: Clu h 1 | β-Parvalbumin

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 109 amino acids

MALASLLKGADIDAALKACEAKDSFKHKDFFAKIGLATKSAADLKKAFEIIDQDKSGFIEEEELKLFLQNFKAGARALTDAETKAFLKAGDADGDGMIGVDEFAVMIKP

UniProt: C6GKU6   IUIS: Clu h 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 110 amino acids

MAFAGLLSDADIAAALGACTAADTFDHKSFFKKVGLSGKSADDVKKPFYIIDQDKSGFIEEEELKLFLQNFKAGARALSDKETKAFLAAGDADGDGMIGVDEFAVMVKAR

UniProt: C6GKU7   IUIS: Clu h 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 109 amino acids

MAFAAFLKEADITAALGACKGADSFDHKAFFAKVGLKGKSGDELKKAFEIIDQDKSGFIEEEELKLFLQNFCKGARALTDGETKKFLKAGDSDNDGKIGIDEFAALINH

UniProt: C6GKU8   IUIS: Clu h 1

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1 Peptide 2 Exp.3 ESP4 CONSeQ5
^ MALASLLK G 0 0.197 0.4112
K GADIDAALK A 0 0.294 0.56118
K AFEIIDQDK S 0 0.34 0.5003
K SGFIEEEELK L 0 0.391 0.547
K LFLQNFK A 0 0.32 0.19254
R ALTDAETK A 0 0.23 0.4154
K AGDADGDGMIGVDEFAVMIKP $ 0 0.407 0.27328
^ MAFAGLLSDADIAAALGACTAADTFDHK S 0 0.557 0.1522
K KPFYIIDQDK S 0 0.261 0.387
K AFLAAGDADGDGMIGVDEFAVMVK A 0 0.462 0.15506
^ MAFAAFLK E 0 0.295 0.38974
K EADITAALGACK G 0 0.565 0.785
K GADSFDHK A 0 0.254 0.14468
K LFLQNFCK G 0 0.362 0.19102
R ALTDGETK K 0 0.21 0.2659
K AGDSDNDGK I 0 0.252 0.10896
K IGIDEFAALINH $ 0 0.536 0.2339

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.