If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AGDADGDGMIGIDEFAVLVK
Peptide within the protein Sal-s-1:
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
References reporting this peptide:
- Nakamura R., et al. Comparative study of GH-transgenic and non-transgenic amago salmon (Oncorhynchus masou ishikawae) allergenicity and proteomic analysis of amago salmon allergens. Regulatory Toxicology and Pharmacology. 2009
Species Uniqueness
Species containing the peptide AGDADGDGMIGIDEFAVLVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Oncorhynchus kisutch | Coho salmon | CBG76586 |
8019 |
| Oncorhynchus mykiss | Rainbow trout | CDQ83771 |
8022 |
| Oncorhynchus nerka | Sockeye salmon | CBG76585 |
8023 |
| Salmo salar | Atlantic salmon | AGZ83059 ACH71041 XP_014049624 NP_001117190 XP_014058479 |
8030 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.