If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: MACAHLCK
Peptide within the protein Sal-s-1:
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide MACAHLCK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Esox lucius | Northern pike | XP_010872533 |
8010 |
| Oncorhynchus kisutch | Coho salmon | CBG76586 |
8019 |
| Oncorhynchus mykiss | Rainbow trout | NP_001182339 CBA35341 CDQ83771 |
8022 |
| Oncorhynchus nerka | Sockeye salmon | CBG76585 |
8023 |
| Salmo salar | Atlantic salmon | ACH71041 XP_014049624 NP_001117190 CBA35349 XP_014058479 |
8030 |
| Salvelinus fontinalis | Brook trout | NP_001182339 |
8038 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.