If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TALEACK
Peptide within the protein Sal-s-1:
MACAHLCKEADIKTALEACKAADTFSFKTFFHTIGFASKSADDVKKAFKVIDQDASGFIEVEELKLFLQNFCPKARELTDAETKAFLKAGDADGDGMIGIDEFAVLVKQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TALEACK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arabidopsis lyrata subsp. lyrata | Arabidopsis lyrata subsp. lyrata | XP_002872923 |
81972 |
| Trichophyton rubrum CBS 100081 | Trichophyton rubrum cbs 100081 | XP_003232408 |
1215328 |
| Trichophyton rubrum CBS 118892 | Trichophyton rubrum cbs 118892 | XP_003232408 |
559305 |
| Arthroderma benhamiae CBS 112371 | Arthroderma benhamiae cbs 112371 | XP_003011494 DAA74052 |
663331 |
| Arthroderma gypseum CBS 118893 | Arthroderma gypseum cbs 118893 | XP_003170805 |
535722 |
| Arthroderma otae CBS 113480 | Arthroderma otae cbs 113480 | XP_002844389 |
554155 |
| Chinchilla lanigera | Long-tailed chinchilla | XP_013358373 |
34839 |
| Colobus angolensis palliatus | Colobus angolensis palliatus | XP_011792905 |
336983 |
| Esox lucius | Northern pike | XP_010872533 |
8010 |
| Eutrema salsugineum | Eutrema salsugineum | XP_006400717 |
72664 |
| Exidia glandulosa HHB12029 | Exidia glandulosa hhb12029 | KZV79477 |
1314781 |
| Exophiala oligosperma | Exophiala oligosperma | XP_016264264 |
215243 |
| Lasius niger | Lasius niger | KMQ97544 |
67767 |
| Marssonina brunnea f. sp. 'multigermtubi' MB_m1 | Marssonina brunnea f. sp. 'multigermtubi' mb_m1 | XP_007290362 |
1072389 |
| Mustela putorius furo | Domestic ferret | XP_004752215 |
9669 |
| Nomascus leucogenys | Northern white-cheeked gibbon | XP_003254379 |
61853 |
| Oncorhynchus mykiss | Rainbow trout | AGG35867 P86431 NP_001182339 CBA35341 CDQ83771 |
8022 |
| Phialocephala scopiformis | Phialocephala scopiformis | XP_018071906 XP_018076996 |
149040 |
| Physcomitrella patens | Physcomitrella patens | XP_001774652 |
3218 |
| Pseudallescheria apiosperma | Pseudallescheria apiosperma | XP_016638516 |
563466 |
| Rousettus aegyptiacus | Egyptian rousette | XP_015998787 XP_015998786 XP_015998785 XP_015998784 |
9407 |
| Salmo salar | Atlantic salmon | AGG35870 XP_014049624 NP_001117190 CBA35349 XP_014058479 |
8030 |
| Salmo trutta | Brown trout | AGG35877 |
8032 |
| Salvelinus alpinus | Arctic char | AGG35867 |
8036 |
| Salvelinus fontinalis | Brook trout | NP_001182339 |
8038 |
| Theobroma cacao | Cacao | EOY32688 |
3641 |
| Trichoderma virens Gv29-8 | Trichoderma virens gv29-8 | XP_013959427 |
413071 |
| Trichophyton rubrum | Trichophyton rubrum | XP_003232408 |
5551 |
| Trichophyton rubrum CBS 202.88 | Trichophyton rubrum cbs 202.88 | XP_003232408 |
1215334 |
| Trichophyton rubrum CBS 288.86 | Trichophyton rubrum cbs 288.86 | XP_003232408 |
1215330 |
| Trichophyton rubrum CBS 289.86 | Trichophyton rubrum cbs 289.86 | XP_003232408 |
1215329 |
| Trichophyton rubrum CBS 735.88 | Trichophyton rubrum cbs 735.88 | XP_003232408 |
1215332 |
| Trichophyton rubrum D6 | Trichophyton rubrum d6 | XP_003232408 |
1215335 |
| Trichophyton rubrum MR1448 | Trichophyton rubrum mr1448 | XP_003232408 |
1215339 |
| Trichophyton rubrum MR1459 | Trichophyton rubrum mr1459 | XP_003232408 |
1215341 |
| Trichophyton rubrum MR850 | Trichophyton rubrum mr850 | XP_003232408 |
1215337 |
| Trichophyton soudanense CBS 452.61 | Trichophyton soudanense cbs 452.61 | XP_003232408 |
1215331 |
| Trichophyton verrucosum HKI 0517 | Trichophyton verrucosum hki 0517 | XP_003021247 |
663202 |
| Trichophyton violaceum | Trichophyton violaceum | XP_003232408 |
34388 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.