Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GVGPSVGV
Peptide within the protein Barley-gluten-P06470:
MKTFLIFALLAIAATSTIAQQQPFPQQPIPQQPQPYPQQPQPYPQQPFPPQQPFPQQPVPQQPQPYPQQPFPPQQPFPQQPPFWQQKPFPQQPPFGLQQPILSQQQPCTPQQTPLPQGQLYQTLLQLQIQYVHPSILQQLNPCKVFLQQQCSPVPVPQRIARSQMLQQSSCHVLQQQCCQQLPQIPEQFRHEAIRAIVYSIFLQEQPQQLVEGVSQPQQQLWPQQVGQCSFQQPQPQQVGQQQQVPQSAFLQPHQIAQLEATTSIALRTLPMMCSVNVPLYRILRGVGPSVGV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GVGPSVGV are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Chlamydomonas reinhardtii | Chlamydomonas reinhardtii | XP_001697423 AAT01224 XP_001697423 AAT01224 XP_001697423 AAT01224 |
3055 |
| Hordeum vulgare | Hordeum vulgare | CAA25913 P06470 CAA25913 P06470 CAA25913 P06470 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | 1103203B ABH01262 1103203B ABH01262 1103203B ABH01262 |
112509 |
| Trypanosoma cruzi | Trypanosoma cruzi | EKG03031 EKG03031 EKG03031 |
5693 |
| Trypanosoma cruzi Dm28c | Trypanosoma cruzi dm28c | ESS63950 ESS63950 ESS63950 |
1416333 |
| Xenopus laevis | African clawed frog | AAI33197 AAI33197 AAI33197 |
8355 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.