Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SQMLQQSSCHVLQQQCCQQLPQIPEQFR
Peptide within the protein Barley-gluten-P06470:
MKTFLIFALLAIAATSTIAQQQPFPQQPIPQQPQPYPQQPQPYPQQPFPPQQPFPQQPVPQQPQPYPQQPFPPQQPFPQQPPFWQQKPFPQQPPFGLQQPILSQQQPCTPQQTPLPQGQLYQTLLQLQIQYVHPSILQQLNPCKVFLQQQCSPVPVPQRIARSQMLQQSSCHVLQQQCCQQLPQIPEQFRHEAIRAIVYSIFLQEQPQQLVEGVSQPQQQLWPQQVGQCSFQQPQPQQVGQQQQVPQSAFLQPHQIAQLEATTSIALRTLPMMCSVNVPLYRILRGVGPSVGV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SQMLQQSSCHVLQQQCCQQLPQIPEQFR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Hordeum bulbosum subsp. bulbosum | Hordeum bulbosum subsp. bulbosum | ALA63864 ALA63864 ALA63864 ALA63864 ALA63864 |
1608635 |
| Hordeum chilense | Hordeum chilense | AAY44809 AAW34187 AAW34186 AAY44809 AAW34187 AAW34186 AAY44809 AAW34187 AAW34186 AAY44809 AAW34187 AAW34186 AAY44809 AAW34187 AAW34186 |
15565 |
| Hordeum vulgare | Hordeum vulgare | CAA25509 CAA25913 CAA60681 P06470 CAA25509 CAA25913 CAA60681 P06470 CAA25509 CAA25913 CAA60681 P06470 CAA25509 CAA25913 CAA60681 P06470 CAA25509 CAA25913 CAA60681 P06470 |
4513 |
| Hordeum vulgare subsp. spontaneum | Hordeum vulgare subsp. spontaneum | ALA63867 ALA63867 ALA63867 ALA63867 ALA63867 |
77009 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | ACU09493 ACU09491 1103203B CAA60681 AFM37566 ALA63869 AKZ20951 ACU09493 ACU09491 1103203B CAA60681 AFM37566 ALA63869 AKZ20951 ACU09493 ACU09491 1103203B CAA60681 AFM37566 ALA63869 AKZ20951 ACU09493 ACU09491 1103203B CAA60681 AFM37566 ALA63869 AKZ20951 ACU09493 ACU09491 1103203B CAA60681 AFM37566 ALA63869 AKZ20951 |
112509 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.