Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TLPTMCSVNVPLYR
Peptide within the protein Barley-gluten-P06471:
QQPVSRQPQQIIPQQPQQPFPLQPQQPQPFPQQPIPQQPQPYPQQPQSFPQQPFPSQQPFPQQPPFWQQQPVLSQQQPCTQDQTPLLQEQQDQMLVQVQIPFVHPSILQQLNPCKVFLQQQCSPLAMSQRIARSQMLQQSSCHVLQQQCCQQLPQIPEQLRHEAVRAIVYSIVLQEQSLQLVQGVSQPQQQSQQQQVGQCSFQQPQPQQGQQQQVPQSVFLQPHQIAQLEATTSIALRTLPTMCSVNVPLYRIVPLAIDTRVGV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TLPTMCSVNVPLYR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aegilops tauschii x Triticum turgidum | Aegilops tauschii x triticum turgidum | AAT76906 |
285950 |
| Hordeum vulgare | Hordeum vulgare | AAA32967 P06471 AFM77748 AFM77746 AFM77745 AFM77744 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | AAB71679 ABB82613 ACU09494 ACU09490 1103203A |
112509 |
| Thinopyrum intermedium | Thinopyrum intermedium | AAO53260 |
85679 |
| Triticum aestivum | Bread wheat | AFX69668 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.