Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VMQQQCCLQLAQIPEQYK
Peptide within the protein Barley-gluten-P17990:
MKILIILTILAMATTFATSEMQVNPSVQVQPTQQQPYPESQQPFISQSQQQFPQPQQPFPQQPQQPFPQSQQQCLQQPQHQFPQPTQQFPQRPLLPFTHPFLTFPDQLLPQPPHQSFPQPPQSYPQPPLQPFPQPPQQKYPEQPQQPFPWQQPTIQLYLQQQLNPCKEFLLQQCRPVSLLSYIWSKIVQQSSCRVMQQQCCLQLAQIPEQYKCTAIDSIVHAIFMQQGQRQGVQIVQQQPQPQQVGQCVLVQGQGVVQPQQLAQMEAIRTLVLQSVPSMCNFNVPPNCSTIKAPFVGVVTGVGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VMQQQCCLQLAQIPEQYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Hordeum vulgare | Hordeum vulgare | P17990 AFM77738 |
4513 |
| Hordeum vulgare subsp. spontaneum | Hordeum vulgare subsp. spontaneum | AEW46823 |
77009 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | 1604464A P17990 AFM77737 |
112509 |
| Triticum aestivum | Bread wheat | CAI78902 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.