Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VFLQQQCSPVR
Peptide within the protein Barley-gluten-Q40021:
MKTFLIFALLAIAATSTIAQQQPFPQQPIPQQPQPYPQQPQPYPQQPFPPQQAFPQQPPFWPQQPFPQQPPFGLQQPILSQQQPCTPQPTPLPQGQLYQTLLQLQIPYVQPSILQQLTPCKVFLQQQCSPVRMPQLIARSQMLQQSSCHVLQQQCCQQLPQIPEQFRHEAIRAIVYSIFLQEQPQQSVQGASQPQQQLQEEQVGQCYFQQPQPQQLGQPQQVPQSVFLQPHQIAQLEATNSIALRTLPTMCNVNVPLYDIMPFGVGTRVGV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VFLQQQCSPVR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Hordeum vulgare | Hordeum vulgare | CAA25509 AFM77743 AFM77740 CAA60681 AFM77741 AFM77742 CAA25509 AFM77743 AFM77740 CAA60681 AFM77741 AFM77742 |
4513 |
| Hordeum vulgare subsp. spontaneum | Hordeum vulgare subsp. spontaneum | ALA63868 ALA63867 ALA63866 ALA63868 ALA63867 ALA63866 |
77009 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | AFM37567 CAA60681 AFM37566 CAA37729 AFM77733 AFM77732 ALA63869 AKZ20951 AAZ76368 AFM37567 CAA60681 AFM37566 CAA37729 AFM77733 AFM77732 ALA63869 AKZ20951 AAZ76368 |
112509 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.