Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: MPQLIAR
Peptide within the protein Barley-gluten-Q40026:
MKTFLIFALLVIAATSTIAQQQPFPQQPFPQQPQPYPQQPQPYPQQPFQPQQPFPQQTIPQQPQPYPQQPFPPQQEFPQQPPFWPQQPFPQQPPFGLQQPILSQQQPCTPQQTPLPQGQLYQTLLQLQIPYVHPSILQQLNPCKVFLQQQCSPVRMPQLIARLQMLQQSSCHVLQQQCCQQLPQISEQFRHEAIRAIVYSIFLQEQPQQSVQGVSQTQQQLQQEQVGQCSFQQPQPQQLGQAQQVPQSVFLQPHQIAQLEATTSIALRTLPRMCNVNVPLYDIMPPDFWH
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide MPQLIAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Caenorhabditis brenneri | Caenorhabditis brenneri | EGT30457 EGT30457 |
135651 |
| Caenorhabditis briggsae | Caenorhabditis briggsae | XP_002644340 XP_002644340 |
6238 |
| Caenorhabditis remanei | Caenorhabditis remanei | XP_003118260 XP_003118260 |
31234 |
| Clupea harengus | Atlantic herring | XP_012681821 XP_012681821 |
7950 |
| Eremothecium sinecaudum | Eremothecium sinecaudum | XP_017988228 XP_017988228 |
45286 |
| Esox lucius | Northern pike | XP_010886899 XP_010886899 |
8010 |
| Fusarium graminearum | Fusarium graminearum | SCB64652 SCB64652 |
5518 |
| Hordeum vulgare | Hordeum vulgare | CAA25509 AFM77743 AFM77740 CAA60681 AFM77741 AFM77742 CAA25509 AFM77743 AFM77740 CAA60681 AFM77741 AFM77742 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | AFM37567 CAA60681 AFM37566 ABA06537 CAA37729 AFM77733 AFM77732 ABB82614 AFM37567 CAA60681 AFM37566 ABA06537 CAA37729 AFM77733 AFM77732 ABB82614 |
112509 |
| Loa loa | Eye worm | EJD75938 XP_003137491 EJD75938 XP_003137491 |
7209 |
| Oncorhynchus mykiss | Rainbow trout | CDQ69323 CDQ69323 |
8022 |
| Panthera tigris altaica | Amur tiger | XP_015395199 XP_015395199 |
74533 |
| Pseudocohnilembus persalinus | Pseudocohnilembus persalinus | KRX08454 KRX08454 |
266149 |
| Salmo salar | Atlantic salmon | XP_013995235 XP_013995234 XP_013995235 XP_013995234 |
8030 |
| fungal sp. No.11243 | Fungal sp. no.11243 | GAM84084 GAM84084 |
1603295 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.