Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: EFLLQQCNPNEK
Peptide within the protein Barley-gluten-Q6EEZ0:
MKIFLLFALLGLATTITTATVQFDPSGHGVQRPQQSYPQWQPVPQQQPFPQQDPQQQLLPQQQPFSQQQQLPQQHPFPQQMPLLPQPPQFPQQQPFAQPQQPLTQQPYPQEQPLSQQQPSVEEQQQLNVCKEFLLQQCNPNEKVSSLQSVIPFLRPQTWQQNSCQLKRQQCCRQLANINEQSRCPAIQTIVHAIVMQQQQVQQQVGHGFIQSQPQQLGQGMPIYPQQQPGHGFFLPQQQAQSFNLVRSLVIQTLPMLCNVHVPPYCSTTTAPFGSMPTGIGGQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide EFLLQQCNPNEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Hordeum chilense | Hordeum chilense | AAQ63852 AAQ63851 AAQ63866 AAQ63868 AAQ63849 AAQ63848 AAQ63850 AAQ63842 AAQ63843 AAQ63845 AAQ63852 AAQ63851 AAQ63866 AAQ63868 AAQ63849 AAQ63848 AAQ63850 AAQ63842 AAQ63843 AAQ63845 |
15565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.