If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GTGGITIK
Peptide within the protein Hor-v-12:
MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVERLGDYLVEQGF
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Wheat | Hor-v-12.0101 | 4513 |
| Wheat | Tri-a-12.0101 | 4565 |
| Wheat | Tri-a-12.0102 | 4565 |
| Wheat | Tri-a-12.0103 | 4565 |
| Wheat | Tri-a-12.0104 | 4565 |
Species containing the peptide GTGGITIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.