If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LGDYLVEQGF
Peptide within the protein Hor-v-12:
MSWQTYVDDHLCCEIDGQHLTSAAILGHDGRVWVQSPNFPQFKPEEIAGIIKDFDEPGHLAPTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMPLILGIYDEPMTPGQCNLVVERLGDYLVEQGF
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LGDYLVEQGF are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Triticum urartu | Triticum urartu | EMS51692 |
4572 |
| Hordeum vulgare | Hordeum vulgare | P52184 |
4513 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | P52184 BAK02673 |
112509 |
| Oryza sativa Japonica Group | Japanese rice | BAS70820 |
39947 |
| Saccharum hybrid cultivar R570 | Saccharum hybrid cultivar r570 | AGT16839 |
131158 |
| Secale cereale x Triticum durum | Secale cereale x triticum durum | AEW90958 |
142809 |
| Sorghum bicolor | Sorghum | XP_002436493 |
4558 |
| Triticum aestivum | Bread wheat | ADK35122 |
4565 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.