If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AGDTDGDGK
Peptide within the protein Lat-c-1:
Isoform: Lat-c-1.0101
MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV
Isoform: Lat-c-1.0201
MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIEEEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVKP
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AGDTDGDGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Gavia stellata | Gavia stellata | XP_009806243 |
37040 |
| Gekko japonicus | Gekko japonicus | XP_015281708 |
146911 |
| Geospiza fortis | Medium ground-finch | XP_005487418 |
48883 |
| Graptemys geographica | Map turtle | P02614 |
8481 |
| Haliaeetus albicilla | White-tailed eagle | XP_009284640 |
8969 |
| Haliaeetus leucocephalus | Bald eagle | XP_009284640 |
52644 |
| Haplochromis burtoni | Burton's mouthbrooder | XP_005925525 |
8153 |
| Ictalurus furcatus | Blue catfish | ADO27803 |
66913 |
| Meleagris gallopavo | Turkey | NP_001007478 |
9103 |
| Ictalurus punctatus | Channel catfish | XP_017348353 AAO25757 |
7998 |
| Larimichthys crocea | Large yellow croaker | XP_010729015 KKF24292 |
215358 |
| Lates calcarifer | Barramundi perch | AAT45383 |
8187 |
| Lepidothrix coronata | Lepidothrix coronata | XP_008926269 |
321398 |
| Leptosomus discolor | Leptosomus discolor | XP_009284640 |
188344 |
| Lutjanus argentimaculatus | Mangrove red snapper | ABQ85439 |
211834 |
| Manacus vitellinus | Golden-collared manakin | KFW88196 XP_008926269 |
328815 |
| Maylandia zebra | Zebra mbuna | XP_004558443 |
106582 |
| Gallus gallus | Chicken | 2KQY_A NP_001007478 |
9031 |
| Acanthisitta chloris | Rifleman | XP_009078220 |
57068 |
| Alligator mississippiensis | American alligator | XP_006031520 KYO30648 |
8496 |
| Alligator sinensis | Chinese alligator | XP_006031520 |
38654 |
| Anas platyrhynchos | Mallard | EOB00978 XP_005020104 |
8839 |
| Anguilla japonica | Japanese eel | BAF98922 |
7937 |
| Anolis carolinensis | Green anole | XP_003230330 |
28377 |
| Anser cygnoides domesticus | Anser cygnoides domesticus | XP_013032544 |
381198 |
| Apaloderma vittatum | Apaloderma vittatum | XP_009867844 |
57397 |
| Aptenodytes forsteri | Emperor penguin | XP_009284640 |
9233 |
| Apteryx australis mantelli | Apteryx australis mantelli | XP_013806360 |
202946 |
| Aquila chrysaetos canadensis | Aquila chrysaetos canadensis | XP_009284640 |
216574 |
| Buceros rhinoceros silvestris | Buceros rhinoceros silvestris | XP_010131772 |
175836 |
| Calypte anna | Anna's hummingbird | XP_008504473 |
9244 |
| Caprimulgus carolinensis | Chuck-will's-widow | XP_009284640 |
279965 |
| Cariama cristata | Red-legged seriema | XP_009701791 |
54380 |
| Cathartes aura | Turkey vulture | KFP54308 |
43455 |
| Chaetura pelagica | Chimney swift | XP_009284640 |
8897 |
| Charadrius vociferus | Charadrius vociferus | XP_008926269 |
50402 |
| Chelonia mydas | Green sea turtle | XP_007060704 EMP34981 |
8469 |
| Chlamydotis undulata macqueenii | Chlamydotis undulata macqueenii | XP_010115214 |
187382 |
| Chrysemys picta bellii | Western painted turtle | XP_005304746 |
8478 |
| Columba livia | Rock pigeon | XP_005514965 EMC89994 |
8932 |
| Corvus brachyrhynchos | American crow | XP_017589638 XP_008631714 |
85066 |
| Corvus cornix cornix | Corvus cornix cornix | XP_008631714 |
932674 |
| Coturnix japonica | Japanese quail | XP_015731978 |
93934 |
| Crotalus oreganus helleri | Southern pacific rattlesnake | AEU60002 |
8741 |
| Cuculus canorus | Common cuckoo | XP_009564310 |
55661 |
| Cynoglossus semilaevis | Tongue sole | XP_008327874 |
244447 |
| Egretta garzetta | Little egret | XP_009647829 |
188379 |
| Electrophorus sp. | Electrophorus sp. | 1206380A |
30772 |
| Eurypyga helias | Sunbittern | XP_010156672 |
54383 |
| Ficedula albicollis | Collared flycatcher | XP_005054577 |
59894 |
| Fulmarus glacialis | Northern fulmar | XP_009582645 |
30455 |
| Merops nubicus | Merops nubicus | XP_008947048 |
57421 |
| Mesitornis unicolor | Brown roatelo | XP_010186078 |
54374 |
| Neolamprologus brichardi | Neolamprologus brichardi | XP_006791598 |
32507 |
| Nipponia nippon | Crested ibis | XP_009284640 |
128390 |
| Ophiophagus hannah | King cobra | ETE59425 |
8665 |
| Oreochromis niloticus | Nile tilapia | XP_003452873 |
8128 |
| Ornithorhynchus anatinus | Platypus | XP_001512095 |
9258 |
| Parus major | Great tit | XP_015497977 |
9157 |
| Pelecanus crispus | Pelecanus crispus | XP_009480305 |
36300 |
| Pelodiscus sinensis | Chinese soft-shelled turtle | XP_006112878 |
13735 |
| Phaethon lepturus | Phaethon lepturus | XP_010280066 |
97097 |
| Phalacrocorax carbo | Great cormorant | XP_009510806 |
9209 |
| Philomachus pugnax | Philomachus pugnax | XP_008926269 |
198806 |
| Phoenicopterus ruber ruber | Phoenicopterus ruber ruber | KFQ78292 KFQ78291 |
9218 |
| Podiceps cristatus | Great crested grebe | KFZ68094 KFQ78291 |
345573 |
| Protobothrops mucrosquamatus | Protobothrops mucrosquamatus | XP_015676247 |
103944 |
| Pseudopodoces humilis | Tibetan ground-tit | XP_005523027 |
181119 |
| Pterocles gutturalis | Yellow-throated sandgrouse | XP_009284640 |
240206 |
| Pundamilia nyererei | Pundamilia nyererei | XP_004558443 |
303518 |
| Pygocentrus nattereri | Red-bellied piranha | XP_017540519 |
42514 |
| Pygoscelis adeliae | Adelie penguin | XP_009284640 |
9238 |
| Python bivittatus | Burmese python | XP_007425219 |
176946 |
| Rastrelliger kanagurta | Indian mackerel | ANW10058 |
70446 |
| Sardinops melanostictus | Sardinops melanostictus | BAF98921 |
41697 |
| Scleropages formosus | Asian bonytongue | KPP59111 |
113540 |
| Serinus canaria | Common canary | XP_009090099 XP_009090098 |
9135 |
| Sparus aurata | Gilthead seabream | ACX94456 |
8175 |
| Struthio camelus australis | Struthio camelus australis | XP_009681636 |
441894 |
| Sturnus vulgaris | Common starling | XP_014725134 |
9172 |
| Takifugu rubripes | Torafugu | XP_011602756 XP_011602190 |
31033 |
| Tetraodon nigroviridis | Spotted green pufferfish | CAG04448 |
99883 |
| Tinamus guttatus | Tinamus guttatus | XP_010221531 |
94827 |
| Trachemys scripta elegans | Trachemys scripta elegans | AAN84529 |
31138 |
| Trichophyton violaceum | Trichophyton violaceum | XP_010729015 |
34388 |
| Tyto alba | Barn owl | XP_009967216 |
56313 |
| Xenopus laevis | African clawed frog | XP_018092549 |
8355 |
| Zonotrichia albicollis | White-throated sparrow | XP_005487418 |
44394 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.