If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DAGTFDHK
Peptide within the protein Lat-c-1:
Isoform: Lat-c-1.0101
MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV
Isoform: Lat-c-1.0201
MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIEEEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVKP
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide DAGTFDHK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Dentex tumifrons | Yellowback seabream | BAK09232 |
119711 |
| Haplochromis burtoni | Burton's mouthbrooder | XP_005925525 |
8153 |
| Lates calcarifer | Barramundi perch | AAT45383 |
8187 |
| Oreochromis niloticus | Nile tilapia | XP_003452873 |
8128 |
| Siniperca chuatsi | Mandarin fish | ADA70320 |
119488 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.