If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IGVDEFAALVK
Peptide within the protein Lat-c-1:
Isoform: Lat-c-1.0101
MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV
Isoform: Lat-c-1.0201
MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIEEEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVKP
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Fish | Cyp-c-1.0101 | 7962 |
| Fish | Lat-c-1.0101 | 8187 |
Species containing the peptide IGVDEFAALVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Astyanax mexicanus | Mexican tetra | XP_007251241 XP_007251241 |
7994 |
| Austrofundulus limnaeus | Austrofundulus limnaeus | XP_013870367 XP_013870367 |
52670 |
| Boreogadus saida | Boreogadus saida | ACN49203 ACN49203 |
44932 |
| Campylomormyrus compressirostris | Campylomormyrus compressirostris | AHI42560 AHI42558 AHI42560 AHI42558 |
389352 |
| Carassius auratus | Goldfish | AET79256 AET79256 |
7957 |
| Clupea harengus | Atlantic herring | XP_012694367 XP_012694367 |
7950 |
| Cynoglossus semilaevis | Tongue sole | XP_008327869 XP_008327869 |
244447 |
| Cyprinodon variegatus | Cyprinodon variegatus | XP_012727819 XP_015234070 XP_012727819 XP_015234070 |
28743 |
| Cyprinus carpio | Common carp | CBA35343 P09227 CAC83658 KTF86532 KTF75949 CBA35343 P09227 CAC83658 KTF86532 KTF75949 |
7962 |
| Dentex tumifrons | Yellowback seabream | BAK09233 BAK09233 |
119711 |
| Fundulus heteroclitus | Mummichog | XP_012727819 XP_012728592 XP_012727819 XP_012728592 |
8078 |
| Haplochromis burtoni | Burton's mouthbrooder | XP_004560823 XP_004560823 |
8153 |
| Hypophthalmichthys molitrix | Silver carp | ACI95745 ACI95745 |
13095 |
| Ictalurus punctatus | Channel catfish | XP_017338080 NP_001187965 XP_017338080 NP_001187965 |
7998 |
| Katsuwonus pelamis | Skipjack tuna | BAF98924 BAF98924 |
8226 |
| Kryptolebias marmoratus | Mangrove rivulus | XP_017277413 XP_017274088 XP_017277413 XP_017274088 |
37003 |
| Larimichthys crocea | Large yellow croaker | XP_010729014 XP_010729014 |
215358 |
| Lates calcarifer | Barramundi perch | AAV97933 AAT45382 AAV97933 AAT45382 |
8187 |
| Lepisosteus oculatus | Spotted gar | XP_006637280 XP_006637280 |
7918 |
| Macruronus magellanicus | Patagonian grenadier | P86741 P86741 |
92050 |
| Macruronus novaezelandiae | Blue grenadier | P86741 P86741 |
248764 |
| Maylandia zebra | Zebra mbuna | XP_004560823 XP_004560823 |
106582 |
| Micropterus salmoides | Largemouth bass | ACN49204 ACN49204 |
27706 |
| Nothobranchius furzeri | Turquoise killifish | XP_015801212 XP_015801212 |
105023 |
| Oreochromis niloticus | Nile tilapia | XP_013129480 XP_013129480 |
8128 |
| Poecilia formosa | Amazon molly | XP_007557481 XP_007557471 XP_007557481 XP_007557471 |
48698 |
| Poecilia latipinna | Sailfin molly | XP_014882510 XP_014882510 |
48699 |
| Poecilia reticulata | Guppy | XP_008415055 XP_008415055 |
8081 |
| Pundamilia nyererei | Pundamilia nyererei | XP_004560823 XP_004560823 |
303518 |
| Pygocentrus nattereri | Red-bellied piranha | XP_017560951 XP_017540534 XP_017560951 XP_017540534 |
42514 |
| Siniperca chuatsi | Mandarin fish | ADA70321 AET79258 ADA70321 AET79258 |
119488 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016345216 XP_016316785 XP_016312395 XP_016345216 XP_016316785 XP_016312395 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016084983 XP_016126230 XP_016084983 XP_016126230 |
75366 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016389250 XP_016389186 XP_016425035 XP_016345216 XP_016389250 XP_016389186 XP_016425035 XP_016345216 |
307959 |
| Sparus aurata | Gilthead seabream | AAT44428 AAT44428 |
8175 |
| Stegastes partitus | Bicolor damselfish | XP_008298713 XP_008286260 XP_008298713 XP_008286260 |
144197 |
| Takifugu rubripes | Torafugu | XP_011602756 XP_011602756 |
31033 |
| Tetraodon nigroviridis | Spotted green pufferfish | CAG04448 CAG04448 |
99883 |
| Trichophyton violaceum | Trichophyton violaceum | XP_010729014 XP_010729014 |
34388 |
| Xiphophorus maculatus | Southern platyfish | XP_005808788 XP_005808788 |
8083 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.