If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LFLQNFSASAR
Peptide within the protein Lat-c-1:
Isoform: Lat-c-1.0101
MAFAGILNEADITAALAACQAADSFKHKDFFVKVGLAGKSDDDVKKAFAVIDQDKSGFIEEDELKLFLQNFSASARALTDAETKEFLKAGDSDGDGKIGVDEFAALVKV
Isoform: Lat-c-1.0201
MAFSNVLSDSDVAAALDGCKDAGTFDHKKFFSACGLSNKTSDDVKKAFAIIDQDKSGFIEEEELKLFLQNFKADARVLTDVETSTFLKAGDTDGDGKIGADEFTALVKP
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Fish | Lat-c-1.0101 | 8187 |
| Fish | Lep-w-1.0101 | 154550 |
Species containing the peptide LFLQNFSASAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Morone saxatilis | Striped sea-bass | ADD52534 ADD52534 |
34816 |
| Neolamprologus brichardi | Neolamprologus brichardi | XP_006801003 XP_006801003 |
32507 |
| Apaloderma vittatum | Apaloderma vittatum | KFP76255 KFP76255 |
57397 |
| Aptenodytes forsteri | Emperor penguin | KFM12339 XP_009284639 KFM12339 XP_009284639 |
9233 |
| Aquila chrysaetos canadensis | Aquila chrysaetos canadensis | XP_011577408 XP_011577408 |
216574 |
| Micropterus salmoides | Largemouth bass | ACN49204 ACN49204 |
27706 |
| Alligator mississippiensis | American alligator | XP_006265337 KYO30647 XP_006265337 KYO30647 |
8496 |
| Alligator sinensis | Chinese alligator | XP_006031519 XP_006031519 |
38654 |
| Astyanax mexicanus | Mexican tetra | XP_007251241 XP_007251240 XP_007251241 XP_007251240 |
7994 |
| Austrofundulus limnaeus | Austrofundulus limnaeus | XP_013883206 XP_013883206 |
52670 |
| Balearica pavonina gibbericeps | Balearica pavonina gibbericeps | KFO11065 XP_010301142 KFO11065 XP_010301142 |
100784 |
| Calypte anna | Anna's hummingbird | XP_008504474 XP_008504474 |
9244 |
| Campylomormyrus compressirostris | Campylomormyrus compressirostris | AHI42560 AHI42560 |
389352 |
| Chaetura pelagica | Chimney swift | XP_010001556 XP_010001556 |
8897 |
| Charadrius vociferus | Charadrius vociferus | KGL86607 XP_009884200 KGL86607 XP_009884200 |
50402 |
| Coturnix japonica | Japanese quail | XP_015731985 XP_015731985 |
93934 |
| Cuculus canorus | Common cuckoo | XP_009564311 XP_009564311 |
55661 |
| Cyprinodon variegatus | Cyprinodon variegatus | XP_012727819 XP_012727819 |
28743 |
| Diplodus holbrookii | Spottail pinfish | ADD52533 ADD52533 |
119713 |
| Eurypyga helias | Sunbittern | XP_010156671 XP_010156671 |
54383 |
| Fulmarus glacialis | Northern fulmar | KFV95267 XP_009582644 KFV95267 XP_009582644 |
30455 |
| Fundulus heteroclitus | Mummichog | XP_012727819 XP_012727819 |
8078 |
| Gadus chalcogrammus | Walleye pollock | Q90YK7 Q90YK7 |
1042646 |
| Gallus gallus | Chicken | XP_015149772 XP_015149772 |
9031 |
| Haliaeetus leucocephalus | Bald eagle | XP_010568531 XP_010568531 |
52644 |
| Haplochromis burtoni | Burton's mouthbrooder | XP_005721753 XP_005721753 |
8153 |
| Kryptolebias marmoratus | Mangrove rivulus | XP_017274088 XP_017274088 |
37003 |
| Lates calcarifer | Barramundi perch | AAV97933 AAV97933 |
8187 |
| Latimeria chalumnae | Coelacanth | XP_005998419 XP_005998419 |
7897 |
| Lepidorhombus whiffiagonis | Megrim | CAP17694 CAP17694 |
154550 |
| Lepisosteus oculatus | Spotted gar | XP_015215998 XP_015215998 |
7918 |
| Leptosomus discolor | Leptosomus discolor | XP_009954231 XP_009954231 |
188344 |
| Maylandia zebra | Zebra mbuna | XP_004562389 XP_004558442 XP_004562389 XP_004558442 |
106582 |
| Oncorhynchus mykiss | Rainbow trout | P86432 CDQ73484 NP_001182340 AAN10126 P86432 CDQ73484 NP_001182340 AAN10126 |
8022 |
| Oreochromis niloticus | Nile tilapia | XP_013129480 XP_013129480 |
8128 |
| Parachaenichthys charcoti | Parachaenichthys charcoti | ACN49189 ACN49189 |
36187 |
| Paralichthys olivaceus | Japanese flounder | BAF98925 BAF98925 |
8255 |
| Philomachus pugnax | Philomachus pugnax | XP_014806850 XP_014806850 |
198806 |
| Phoenicopterus ruber ruber | Phoenicopterus ruber ruber | KFQ78292 KFQ78292 |
9218 |
| Podiceps cristatus | Great crested grebe | KFZ68094 KFZ68094 |
345573 |
| Poecilia formosa | Amazon molly | XP_007557481 XP_007557481 |
48698 |
| Poecilia latipinna | Sailfin molly | XP_014882510 XP_014882510 |
48699 |
| Poecilia reticulata | Guppy | XP_008436379 XP_008436379 |
8081 |
| Pseudochaenichthys georgianus | South georgia icefish | ACN49196 ACN49196 |
52239 |
| Pundamilia nyererei | Pundamilia nyererei | XP_005721753 XP_005721753 |
303518 |
| Pygoscelis adeliae | Adelie penguin | XP_009318271 XP_009318271 |
9238 |
| Salmo salar | Atlantic salmon | ADD52536 NP_001182340 NP_001117189 XP_014064375 ADD52536 NP_001182340 NP_001117189 XP_014064375 |
8030 |
| Salvelinus alpinus | Arctic char | AAN10126 AAN10126 |
8036 |
| Salvelinus fontinalis | Brook trout | NP_001182340 NP_001182340 |
8038 |
| Scleropages formosus | Asian bonytongue | KPP59111 KPP59111 |
113540 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016126230 XP_016126230 |
75366 |
| Takifugu rubripes | Torafugu | XP_011602756 XP_011602188 XP_011602756 XP_011602188 |
31033 |
| Tetraodon nigroviridis | Spotted green pufferfish | CAG03147 CAG04448 CAG03147 CAG04448 |
99883 |
| Xenopus (Silurana) tropicalis | Western clawed frog | NP_001123669 OCA22623 NP_001123669 OCA22623 |
8364 |
| Xenopus laevis | African clawed frog | XP_018091912 P05940 NP_001167478 NP_001079519 OCT64207 AAA49925 XP_018091912 P05940 NP_001167478 NP_001079519 OCT64207 AAA49925 |
8355 |
| Xiphophorus maculatus | Southern platyfish | XP_005811742 XP_005811742 |
8083 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.