Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LTSAVNEIEK
Peptide within the protein Pen-m-2:
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Cra-c-2.0101 | 491138 |
| Shrimp | Lit-v-2.0101 | 6689 |
| Shrimp | Pen-m-2.0101 | 6687 |
Species containing the peptide LTSAVNEIEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Metapenaeus ensis | Metapenaeus ensis | ACA51932 ACA51932 ACA51932 |
32278 |
| Penaeus monodon | Black tiger shrimp | AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 |
6687 |
| Crangon crangon | Crangon crangon | ACR43474 ACR43474 ACR43474 |
491138 |
| Culex quinquefasciatus | Southern house mosquito | XP_001849654 XP_001849654 XP_001849654 |
7176 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | AAV83993 AAV83993 AAV83993 |
139456 |
| Fenneropenaeus merguiensis | Fenneropenaeus merguiensis | ACP43442 ACP43442 ACP43442 |
71412 |
| Litopenaeus vannamei | Pacific white shrimp | ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 |
6689 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | P51545 P51545 P51545 |
27405 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.