Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Black tiger shrimp Protein: Pen m 4 | Sarcoplasmic Calcium Binding Protein
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 193 amino acids
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
UniProt: E7CGC4 IUIS: Pen m 4Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MAYSWDNR | V | 0 | 0.31 | 0.14036 |
| R | YMYDIDNNGFLDK | N | 0 | 0.544 | 0.2747 |
| K | NDFECLAVR | N | 0 | 0.482 | 0.43732 |
| R | NTLIEGR | G | 0 | 0.268 | 0.22318 |
| R | GEFSADAYANNQK | I | 0 | 0.534 | 0.49476 |
| R | NLWNEIAELADFNK | D | 0 | 0.593 | 0.43648 |
| K | DGEVTVDEFK | Q | 0 | 0.41 | 0.602 |
| K | YGDFPGAFK | V | 0 | 0.495 | 0.4116 |
| K | VFIANQFK | A | 0 | 0.363 | 0.27084 |
| K | AIDVNGDGK | V | 0 | 0.281 | 0.3898 |
| K | VGLDEYR | L | 0 | 0.267 | 0.3523 |
| R | SAFAEVK | E | 0 | 0.218 | 0.19356 |
| K | EIDDAYNK | L | 0 | 0.257 | 0.23824 |
| K | LTTEDDR | K | 0 | 0.229 | 0.11912 |
| K | AGGLTLER | Y | 0 | 0.28 | 0.45292 |
| R | YQDLYAQFISNPDESCSACYLFGPLK | V | 0 | 0.42 | 0.04198 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.