If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: FLIEEDEEALK
Peptide within the protein Pen-m-6:
MDSLDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTDLEGIIEEVDEDGSGTLDFDEFMEMMSG
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Cra-c-6.0101 | 491138 |
| Lobster | Hom-a-6.0101 | 6706 |
| Shrimp | Pen-m-6.0101 | 6687 |
Species containing the peptide FLIEEDEEALK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Caligus clemensi | Caligus clemensi | ACO15082 ACO15082 ACO15082 |
344056 |
| Caligus rogercresseyi | Caligus rogercresseyi | ACO10773 ACO10773 ACO10773 |
217165 |
| Crangon crangon | Crangon crangon | ACR43478 ACR43478 ACR43478 |
491138 |
| Homarus americanus | American lobster | ACS36541 P29291 P29290 ACS36540 ACS36542 ACS36541 P29291 P29290 ACS36540 ACS36542 ACS36541 P29291 P29290 ACS36540 ACS36542 |
6706 |
| Lepeophtheirus salmonis | Salmon louse | ACO12630 ACO12630 ACO12630 |
72036 |
| Litopenaeus vannamei | Pacific white shrimp | AET36896 AET36896 AET36896 |
6689 |
| Penaeus monodon | Black tiger shrimp | ADV17344 ADV17344 ADV17344 |
6687 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P06708 P06708 P06708 |
6717 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.