Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AVFDQLK
Peptide within the protein Pen-m-2:
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AVFDQLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Blumeria graminis f. sp. tritici 96224 | Blumeria graminis f. sp. tritici 96224 | EPQ66050 |
1268274 |
| Brassica napus | Rape | CDX89242 XP_013655704 CDY19058 |
3708 |
| Brassica rapa | Field mustard | XP_009143539 |
3711 |
| Colletotrichum gloeosporioides Cg-14 | Colletotrichum gloeosporioides cg-14 | EQB49416 |
1237896 |
| Colletotrichum gloeosporioides Nara gc5 | Colletotrichum gloeosporioides nara gc5 | XP_007286891 |
1213859 |
| Colletotrichum higginsianum | Colletotrichum higginsianum | CCF37193 |
80884 |
| Colletotrichum higginsianum IMI 349063 | Colletotrichum higginsianum imi 349063 | CCF37193 |
759273 |
| Dacryopinax primogenitus | Dacryopinax primogenitus | EJU02737 |
1858805 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | AAV83993 |
139456 |
| Klebsormidium flaccidum | Klebsormidium flaccidum | GAQ88198 |
3175 |
| Neofusicoccum parvum UCRNP2 | Neofusicoccum parvum ucrnp2 | XP_007586174 |
1287680 |
| Penaeus monodon | Black tiger shrimp | AAO15713 AGV55412 C7E3T4 |
6687 |
| Sorghum bicolor | Sorghum | XP_002447338 |
4558 |
| Stachybotrys chlorohalonata IBT 40285 | Stachybotrys chlorohalonata ibt 40285 | KFA69305 |
1283841 |
| Trachipleistophora hominis | Trachipleistophora hominis | ELQ73967 |
72359 |
| uncultured organism | Uncultured organism | ADX05742 |
155900 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.