Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEM
None.
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Cra-c-2.0101 | 491138 |
| Shrimp | Pen-m-2.0101 | 6687 |
Species containing the peptide SMEGYPFNPCLTEAQYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aratus pisonii | Aratus pisonii | ACB46948 ACB46948 |
106741 |
| Arcania cornuta | Arcania cornuta | AIT97361 AIT97361 |
1550652 |
| Acrocercops distylii | Acrocercops distylii | ADJ53622 ADJ53622 |
796984 |
| Acrocercops querci | Acrocercops querci | ADJ53623 ADJ53623 |
796985 |
| Actaeodes cf. tomentosus LMT-2014 | Actaeodes cf. tomentosus lmt-2014 | AIT97363 AIT97363 |
1550556 |
| Aedes aegypti | Yellow fever mosquito | XP_001653723 XP_001653723 |
7159 |
| Aedes albopictus | Asian tiger mosquito | KXJ74851 KXJ84163 KXJ74851 KXJ84163 |
7160 |
| Aethra scruposa | Aethra scruposa | AIT97365 AIT97365 |
405179 |
| Agulla sp. RA63 | Agulla sp. ra63 | ANW43804 ANW43804 |
1748523 |
| Alsophila japonensis | Alsophila japonensis | BAK95986 BAK95986 |
393318 |
| Alsophila zabolne | Alsophila zabolne | BAK95992 BAK95992 |
749363 |
| Alucita hexadactyla | Alucita hexadactyla | ANT95743 ANT95743 |
753150 |
| Amyelois transitella | Amyelois transitella | XP_013183950 XP_013183950 |
680683 |
| Anasa tristis | Squash bug | AFK29278 AFK29278 |
236421 |
| Ancyluris aulestes | Ancyluris aulestes | ANJ59727 ANJ59727 |
1859604 |
| Anopheles atroparvus | Anopheles atroparvus | ADB80247 ADB80247 |
41427 |
| Anopheles darlingi | Anopheles darlingi | ETN62321 ETN62321 |
43151 |
| Carcinoplax purpurea | Carcinoplax purpurea | AIT97376 AIT97376 |
1550537 |
| Anopheles gambiae str. PEST | Anopheles gambiae str. pest | XP_306771 XP_001688696 XP_315641 XP_306771 XP_001688696 XP_315641 |
180454 |
| Anopheles sinensis | Anopheles sinensis | KFB47038 KFB47038 |
74873 |
| Apamea crenata | Apamea crenata | ANT95745 ANT95745 |
753153 |
| Arcotheres sp. LMT-2014 | Arcotheres sp. lmt-2014 | AIT97364 AIT97364 |
1550557 |
| Arenaeus cribrarius | Arenaeus cribrarius | ACB46947 ACB46947 |
375456 |
| Armases cinereum | Armases cinereum | ACB46946 ACB46946 |
285640 |
| Artifodina japonica | Artifodina japonica | ADJ53625 ADJ53625 |
796994 |
| Atergatis integerrimus | Atergatis integerrimus | AIT97363 AIT97363 |
903645 |
| Austinogebia edulis | Austinogebia edulis | ADU87600 ADU87600 |
516884 |
| Bactridium sp. DDM0891 | Bactridium sp. ddm0891 | ANW43828 ANW43828 |
1735819 |
| Bironella gracilis | Bironella gracilis | ADB80248 ADB80248 |
53566 |
| Borboryctis euryae | Borboryctis euryae | ADJ53626 ADJ53626 |
796996 |
| Bucculatrix sp. 1 ex Rhamnus costata | Bucculatrix sp. 1 ex rhamnus costata | ADJ53643 ADJ53643 |
796967 |
| Bucculatrix sp. 2 ex Hovenia tomentella | Bucculatrix sp. 2 ex hovenia tomentella | ADJ53644 ADJ53644 |
796968 |
| Calappa philargius | Calappa philargius | AIT97375 AIT97375 |
271494 |
| Calcinus laevimanus | Calcinus laevimanus | ADU87558 ADU87558 |
651129 |
| Callinectes sapidus | Blue crab | ACB46939 Q9NH49 ACB46939 Q9NH49 |
6763 |
| Caloptilia acericola | Caloptilia acericola | BAV44283 BAV44283 |
1806594 |
| Caloptilia alni | Caloptilia alni | BAV44278 BAV44278 |
1806596 |
| Caloptilia aurifasciata | Caloptilia aurifasciata | BAV44279 BAV44279 |
1806597 |
| Caloptilia azaleella | Caloptilia azaleella | BAV44295 BAV44295 |
199010 |
| Caloptilia bipunctata | Caloptilia bipunctata | BAV44320 BAV44320 |
1806598 |
| Caloptilia camphorae | Caloptilia camphorae | BAV44288 BAV44288 |
1806599 |
| Epicephala sp. 2 ex Glochidion lanceolatum | Epicephala sp. 2 ex glochidion lanceolatum | ABC02904 ABC02904 |
361201 |
| Caloptilia cecidophora | Caloptilia cecidophora | ADJ53584 BAV44295 ADJ53584 BAV44295 |
796986 |
| Caloptilia celtidis | Caloptilia celtidis | BAV44274 BAV44274 |
1806600 |
| Caloptilia cf. geminata RN-2016 | Caloptilia cf. geminata rn-2016 | BAV44280 BAV44280 |
1806628 |
| Caloptilia cf. yasudai RN-2016 | Caloptilia cf. yasudai rn-2016 | BAV44318 BAV44318 |
1806631 |
| Caloptilia cf. zachrysa RN-2016 | Caloptilia cf. zachrysa rn-2016 | BAV44295 BAV44295 |
1806632 |
| Caloptilia chrysolampra | Caloptilia chrysolampra | BAV44317 BAV44317 |
1806601 |
| Caloptilia crinotibialis | Caloptilia crinotibialis | BAV44300 BAV44300 |
1806602 |
| Caloptilia isochrysa | Caloptilia isochrysa | BAV44318 BAV44318 |
1806608 |
| Caloptilia kadsurae | Caloptilia kadsurae | BAV44277 BAV44277 |
1806609 |
| Caloptilia kisoensis | Caloptilia kisoensis | BAV44281 BAV44281 |
1806610 |
| Caloptilia matsumurai | Caloptilia matsumurai | BAV44303 BAV44303 |
1806613 |
| Caloptilia monticola | Caloptilia monticola | BAV44284 BAV44284 |
1806614 |
| Caloptilia querci | Caloptilia querci | BAV44292 BAV44292 |
1806616 |
| Caloptilia recitata | Caloptilia recitata | ADJ53586 ADJ53586 |
796987 |
| Caloptilia rhois | Caloptilia rhois | BAV44276 BAV44276 |
1806617 |
| Caloptilia ryukyuensis | Caloptilia ryukyuensis | BAV44295 BAV44295 |
796988 |
| Caloptilia sapiivora | Caloptilia sapiivora | BAV44275 BAV44275 |
1806618 |
| Caloptilia sapporella | Caloptilia sapporella | BAV44298 BAV44298 |
1075126 |
| Caloptilia semifasciella | Caloptilia semifasciella | BAV44285 BAV44285 |
1806619 |
| Caloptilia sp. RN-2016 | Caloptilia sp. rn-2016 | BAV44316 BAV44314 BAV44311 BAV44309 BAV44307 BAV44287 BAV44294 BAV44292 BAV44319 BAV44313 BAV44312 BAV44296 BAV44316 BAV44314 BAV44311 BAV44309 BAV44307 BAV44287 BAV44294 BAV44292 BAV44319 BAV44313 BAV44312 BAV44296 |
1806633 |
| Caloptilia syrphetias | Caloptilia syrphetias | BAV44293 BAV44293 |
1806621 |
| Caloptilia wakayamensis | Caloptilia wakayamensis | BAV44295 BAV44295 |
1806622 |
| Calybites phasianipennella | Calybites phasianipennella | ADJ53621 BAV44297 ADJ53621 BAV44297 |
796989 |
| Calybites trimaculata | Calybites trimaculata | BAV44308 BAV44308 |
1806625 |
| Cancer irroratus | Atlantic rock crab | ACB46943 ACB46943 |
6756 |
| Cancer jordani | Cancer jordani | ACB46942 ACB46942 |
504413 |
| Carcinus maenas | Green crab | ACB46940 Q9U9J4 ACB46940 Q9U9J4 |
6759 |
| Cardisoma crassum | Cardisoma crassum | AIT97368 AIT97368 |
84637 |
| Carpilius maculatus | Carpilius maculatus | AIT97373 AIT97373 |
205348 |
| Chaoborus astictopus | Chaoborus astictopus | ADB80268 ADB80268 |
53523 |
| Charybdis feriata | Charybdis feriata | AIT97370 AIT97370 |
65693 |
| Chilo suppressalis | Striped riceborer | AME17984 ALX37956 AME17984 ALX37956 |
168631 |
| Choreutis pariana | Choreutis pariana | ANT95750 ANT95750 |
687022 |
| Cimex lectularius | Bed bug | XP_014239180 XP_014239180 |
79782 |
| Clastoptera arizonana | Arizona spittle bug | JAS27981 JAS27981 |
38151 |
| Clibanarius englaucus | Clibanarius englaucus | ADU87579 ADU87579 |
638972 |
| Clibanarius virescens | Clibanarius virescens | ADU87559 ADU87559 |
638979 |
| Coenobita rugosus | Coenobita rugosus | ADU87561 ADU87561 |
516887 |
| Coenobita violascens | Coenobita violascens | ADU87560 ADU87560 |
516888 |
| Conchoecetes artificiosus | Conchoecetes artificiosus | ADU87598 ADU87598 |
516906 |
| Conopomorpha litchiella | Conopomorpha litchiella | ADJ53617 ADJ53617 |
796991 |
| Coquillettidia perturbans | Coquillettidia perturbans | ADB80250 ADB80250 |
329111 |
| Crangon crangon | Crangon crangon | ACR43474 ACR43474 |
491138 |
| Crossotarsus externedentatus | Crossotarsus externedentatus | AKS49998 AKS49998 |
591146 |
| Cryptopodia fornicata | Cryptopodia fornicata | AIT97371 AIT97371 |
516908 |
| Ctenocephalides felis | Cat flea | CAZ65716 CAZ65720 CAZ65719 CAZ65717 CAZ65716 CAZ65720 CAZ65719 CAZ65717 |
7515 |
| Culex quinquefasciatus | Southern house mosquito | XP_001849654 XP_001849654 |
7176 |
| Culiseta inornata | Culiseta inornata | ADB80249 ADB80249 |
704160 |
| Cuphodes diospyrosella | Cuphodes diospyrosella | ADJ53588 ADJ53587 ACL26938 ADJ53588 ADJ53587 ACL26938 |
586054 |
| Eplumula phalangium | Eplumula phalangium | AIT97388 AIT97388 |
516912 |
| Cuphodes sp. 1 ex Berchemiella berchemiaefolia/Berchemia racemosa | Cuphodes sp. 1 ex berchemiella berchemiaefolia/berchemia racemosa | ADJ53588 ADJ53593 ADJ53588 ADJ53593 |
796961 |
| Cuphodes sp. 2 ex Rhamnus crenata | Cuphodes sp. 2 ex rhamnus crenata | ADJ53592 ADJ53592 |
796962 |
| Cuphodes sp. 6 ex Diospyros kaki/Diospyros japonica/Diospyros lotus | Cuphodes sp. 6 ex diospyros kaki/diospyros japonica/diospyros lotus | ADJ53604 ADJ53604 |
796966 |
| Epicephala sp. E AK-2014 | Epicephala sp. e ak-2014 | BAQ21700 BAQ21700 |
1526519 |
| Cuphodes wisteriella | Cuphodes wisteriella | ADJ53592 ADJ53591 ADJ53590 ADJ53592 ADJ53591 ADJ53590 |
859245 |
| Cyclophora punctaria | Maiden's blush | ANT95731 ANT95731 |
310442 |
| Dacryomaia sp. LMT-2014 | Dacryomaia sp. lmt-2014 | AIT97379 AIT97379 |
1550560 |
| Dardanus impressus | Dardanus impressus | ADU87562 ADU87562 |
516889 |
| Dardanus setifer | Dardanus setifer | ADU87563 ADU87563 |
941196 |
| Deoptilia heptadeta | Deoptilia heptadeta | ADJ53627 ADJ53627 |
797000 |
| Diphtheroptila sp. 1 ex Glochidion acuminatum/Glochidion obovatum | Diphtheroptila sp. 1 ex glochidion acuminatum/glochidion obovatum | ADJ53579 ADJ53579 |
796971 |
| Diphtheroptila sp. 2 ex Glochidion philippicum/Glochidion rubrum | Diphtheroptila sp. 2 ex glochidion philippicum/glochidion rubrum | ADJ53579 ADJ53579 |
796972 |
| Diphtheroptila sp. 3 ex Glochidion acuminatum/Glochidion obovatum | Diphtheroptila sp. 3 ex glochidion acuminatum/glochidion obovatum | ADJ53579 ADJ53579 |
796973 |
| Diphtheroptila sp. 4 ex Glochidion zeylanicum/Glochidion lanceolatum | Diphtheroptila sp. 4 ex glochidion zeylanicum/glochidion lanceolatum | ADJ53579 ADJ53579 |
796974 |
| Diphtheroptila sp. 5 ex Bridelia balansae | Diphtheroptila sp. 5 ex bridelia balansae | ADJ53579 ADJ53579 |
796975 |
| Doclea japonica | Doclea japonica | AIT97381 AIT97381 |
1550657 |
| Dorippe quadridens | Dorippe quadridens | AIT97383 AIT97383 |
547229 |
| Dotilla myctiroides | Dotilla myctiroides | AIT97382 AIT97382 |
1550540 |
| Dotilla wichmanni | Dotilla wichmanni | AIT97382 AIT97382 |
78109 |
| Dufourea novaeangliae | Dufourea novaeangliae | XP_015432501 KZC10522 XP_015432501 KZC10522 |
178035 |
| Epermenia illigerella | Epermenia illigerella | ANT95747 ANT95747 |
753320 |
| Epicephala sp. 1 ex Glochidion lanceolatum | Epicephala sp. 1 ex glochidion lanceolatum | ABC02914 ABC02899 ABC02914 ABC02899 |
360563 |
| Epicephala sp. 1 ex Glochidion obovatum/Glochidion rubrum | Epicephala sp. 1 ex glochidion obovatum/glochidion rubrum | ABC02904 ABC02904 |
360564 |
| Epicephala sp. 2 ex Glochidion obovatum/Glochidion rubrum | Epicephala sp. 2 ex glochidion obovatum/glochidion rubrum | ABC02946 ABC02946 |
360565 |
| Epicephala sp. A AK-2014 | Epicephala sp. a ak-2014 | BAQ21701 BAQ21701 |
1526515 |
| Epicephala sp. B AK-2014 | Epicephala sp. b ak-2014 | BAQ21699 BAQ21699 |
1526516 |
| Epicephala sp. C AK-2014 | Epicephala sp. c ak-2014 | BAQ21700 BAQ21700 |
1526517 |
| Epicephala sp. E110AT | Epicephala sp. e110at | AAS92309 AAS92309 |
271649 |
| Epicephala sp. E121AT | Epicephala sp. e121at | AAS92311 AAS92311 |
271650 |
| Epicephala sp. E124AT | Epicephala sp. e124at | AAS92296 AAS92296 |
271651 |
| Epicephala sp. E128AT | Epicephala sp. e128at | AAS92301 AAS92301 |
271653 |
| Epicephala sp. E129AT | Epicephala sp. e129at | AAS92307 AAS92307 |
271654 |
| Epicephala sp. E14AT | Epicephala sp. e14at | AAS92310 AAS92310 |
271655 |
| Epicephala sp. E36AT | Epicephala sp. e36at | AAS92308 AAS92308 |
271656 |
| Epicephala sp. E37AT | Epicephala sp. e37at | AAS92305 AAS92305 |
271657 |
| Epicephala sp. E38AT | Epicephala sp. e38at | AAS92295 AAS92295 |
271753 |
| Epicephala sp. E39AT | Epicephala sp. e39at | AAS92306 AAS92306 |
271658 |
| Epicephala sp. E56AT | Epicephala sp. e56at | AAS92304 AAS92304 |
271659 |
| Epicephala sp. E87AT | Epicephala sp. e87at | AAS92299 AAS92299 |
271660 |
| Epicephala sp. E88AT | Epicephala sp. e88at | AAS92298 AAS92298 |
271661 |
| Epicephala sp. E90AT | Epicephala sp. e90at | AAS92300 AAS92300 |
271662 |
| Epicephala sp. E91AT | Epicephala sp. e91at | AAS92299 AAS92299 |
271663 |
| Epicephala sp. E93AT | Epicephala sp. e93at | AAS92297 AAS92297 |
271664 |
| Epicephala sp. E94AT | Epicephala sp. e94at | AAS92299 AAS92299 |
271665 |
| Epicephala sp. E95AT | Epicephala sp. e95at | AAS92313 AAS92313 |
271666 |
| Epicephala sp. E97AT | Epicephala sp. e97at | AAS92314 AAS92314 |
271754 |
| Epicephala sp. F AK-2014 | Epicephala sp. f ak-2014 | BAQ21703 BAQ21703 |
1526520 |
| Epicephala sp. ex Breynia disticha | Epicephala sp. ex breynia disticha | ABC02946 ABC02946 |
586031 |
| Epicephala sp. ex Breynia fruticosa | Epicephala sp. ex breynia fruticosa | ACL26928 ACL26928 |
586032 |
| Epicephala sp. ex Breynia oblongifolia | Epicephala sp. ex breynia oblongifolia | ACL26928 ACL26928 |
586033 |
| Epicephala sp. ex Breynia vitisidea | Epicephala sp. ex breynia vitisidea | ACL26929 ACL26929 |
586035 |
| Epicephala sp. ex Flueggea suffruticosa | Epicephala sp. ex flueggea suffruticosa | ACL26917 ACL26917 |
586036 |
| Epicephala sp. ex Glochidion acuminatum | Epicephala sp. ex glochidion acuminatum | ABD92981 ABC02884 ABD92981 ABC02884 |
360562 |
| Epicephala sp. ex Glochidion brunneum E.sp_LambirC | Epicephala sp. ex glochidion brunneum e.sp_lambirc | AAS92297 AAS92297 |
1383326 |
| Epicephala sp. ex Glochidion eriocarpum E.eriocarpumC | Epicephala sp. ex glochidion eriocarpum e.eriocarpumc | AAS92314 AAS92314 |
1383328 |
| Epicephala sp. ex Glochidion eriocarpum E.eriocarpumL | Epicephala sp. ex glochidion eriocarpum e.eriocarpuml | AAS92314 AAS92314 |
1383329 |
| Epicephala sp. ex Glochidion glomerulatum E.sp_LambirA | Epicephala sp. ex glochidion glomerulatum e.sp_lambira | AAS92299 AAS92299 |
1383330 |
| Epicephala sp. ex Glochidion kunstlerianum E.spB_Lambir370 | Epicephala sp. ex glochidion kunstlerianum e.spb_lambir370 | AAS92297 AAS92297 |
1383331 |
| Epicephala sp. ex Glochidion kunstlerianum E.spB_Mulu371 | Epicephala sp. ex glochidion kunstlerianum e.spb_mulu371 | AAS92297 AAS92297 |
1383332 |
| Epicephala sp. ex Glochidion littorale E.littorale_374 | Epicephala sp. ex glochidion littorale e.littorale_374 | AAS92299 AAS92299 |
1383333 |
| Epicephala sp. ex Glochidion lutescens E.spF_Lambir373 | Epicephala sp. ex glochidion lutescens e.spf_lambir373 | AAS92299 AAS92299 |
1383334 |
| Epicephala sp. ex Glochidion lutescens E.sp_LambirF | Epicephala sp. ex glochidion lutescens e.sp_lambirf | AAS92299 AAS92299 |
1383335 |
| Epicephala sp. ex Glochidion obscurum E.spJ_Limbang376 | Epicephala sp. ex glochidion obscurum e.spj_limbang376 | AAS92306 AAS92306 |
1383336 |
| Epicephala sp. ex Glochidion obscurum E.spJ_Mulu375 | Epicephala sp. ex glochidion obscurum e.spj_mulu375 | AAS92306 AAS92306 |
1383337 |
| Epicephala sp. ex Glochidion sp. E.spG_Lambir372 | Epicephala sp. ex glochidion sp. e.spg_lambir372 | AAS92314 AAS92314 |
1383338 |
| Epicephala sp. ex Glochidion sp. E.sp_Assam | Epicephala sp. ex glochidion sp. e.sp_assam | AAS92299 AAS92299 |
1383339 |
| Epicephala sp. ex Glochidion sp. E.sp_LambirI | Epicephala sp. ex glochidion sp. e.sp_lambiri | AAS92297 AAS92297 |
1383341 |
| Epicephala sp. ex Glochidion sp. E.sp_Phonsavan | Epicephala sp. ex glochidion sp. e.sp_phonsavan | AGT36929 AGT36929 |
1383342 |
| Epicephala sp. ex Glochidion zeylanicum | Epicephala sp. ex glochidion zeylanicum | ABC02899 ABC02899 |
360566 |
| Epicephala sp. ex Phyllanthus aeneus | Epicephala sp. ex phyllanthus aeneus | ACL26926 ACL26926 |
586037 |
| Epicephala sp. ex Phyllanthus amarus | Epicephala sp. ex phyllanthus amarus | ACL26937 ACL26937 |
586038 |
| Epicephala sp. ex Phyllanthus bourgeoisii | Epicephala sp. ex phyllanthus bourgeoisii | ACL26920 ACL26920 |
586039 |
| Epicephala sp. ex Phyllanthus caudatus | Epicephala sp. ex phyllanthus caudatus | ACL26921 ACL26921 |
586040 |
| Epicephala sp. ex Phyllanthus cf. nitidus E.sp_LambirE | Epicephala sp. ex phyllanthus cf. nitidus e.sp_lambire | AAS92299 AAS92299 |
1384208 |
| Epicephala sp. ex Phyllanthus chamaecerasus | Epicephala sp. ex phyllanthus chamaecerasus | ACL26918 ACL26918 |
586041 |
| Epicephala sp. ex Phyllanthus concolor dhh08308a | Epicephala sp. ex phyllanthus concolor dhh08308a | AGT36895 AGT36895 |
1383344 |
| Epicephala sp. ex Phyllanthus cordatus dhh10058a | Epicephala sp. ex phyllanthus cordatus dhh10058a | AGT36910 AGT36910 |
1383346 |
| Epicephala sp. ex Phyllanthus cuspidatus neg1aa | Epicephala sp. ex phyllanthus cuspidatus neg1aa | AGT36909 AGT36909 |
1383347 |
| Epicephala sp. ex Phyllanthus emarginatus dhh08456c | Epicephala sp. ex phyllanthus emarginatus dhh08456c | AAS92299 AAS92299 |
1383348 |
| Epicephala sp. ex Phyllanthus florencei dhh07450a | Epicephala sp. ex phyllanthus florencei dhh07450a | AGT36906 AGT36906 |
1383349 |
| Epicephala sp. ex Phyllanthus florencei dhh08143a | Epicephala sp. ex phyllanthus florencei dhh08143a | AGT36893 AGT36893 |
1383350 |
| Epicephala sp. ex Phyllanthus florencei dhh08445a | Epicephala sp. ex phyllanthus florencei dhh08445a | AGT36921 AGT36921 |
1383351 |
| Epicephala sp. ex Phyllanthus florencei dhh08473a | Epicephala sp. ex phyllanthus florencei dhh08473a | AGT36924 AGT36924 |
1383352 |
| Epicephala sp. ex Phyllanthus gneissicus | Epicephala sp. ex phyllanthus gneissicus | ACL26923 ACL26923 |
586042 |
| Epicephala sp. ex Phyllanthus grayanus dhh07434a | Epicephala sp. ex phyllanthus grayanus dhh07434a | AGT36893 AGT36893 |
1383353 |
| Epicephala sp. ex Phyllanthus guillauminii | Epicephala sp. ex phyllanthus guillauminii | ACL26923 ACL26923 |
586043 |
| Epicephala sp. ex Phyllanthus humbertii | Epicephala sp. ex phyllanthus humbertii | ACL26933 ACL26933 |
586044 |
| Epicephala sp. ex Phyllanthus koniamboensis | Epicephala sp. ex phyllanthus koniamboensis | ACL26919 ACL26919 |
586045 |
| Epicephala sp. ex Phyllanthus lepidocarpus | Epicephala sp. ex phyllanthus lepidocarpus | ACL26935 ACL26935 |
586046 |
| Epicephala sp. ex Phyllanthus longfieldiae dhh08255a | Epicephala sp. ex phyllanthus longfieldiae dhh08255a | AAS92299 AAS92299 |
1383355 |
| Epicephala sp. ex Phyllanthus mangenotii | Epicephala sp. ex phyllanthus mangenotii | ACL26918 ACL26918 |
586047 |
| Epicephala sp. ex Phyllanthus manono dhh07335b | Epicephala sp. ex phyllanthus manono dhh07335b | AGT36905 AGT36905 |
1383356 |
| Epicephala sp. ex Phyllanthus manono dhh07429a | Epicephala sp. ex phyllanthus manono dhh07429a | AAS92299 AAS92299 |
1383357 |
| Epicephala sp. ex Phyllanthus marchionicus dhh07151a | Epicephala sp. ex phyllanthus marchionicus dhh07151a | AAS92299 AAS92299 |
1383359 |
| Epicephala sp. ex Phyllanthus marchionicus dhh07169a | Epicephala sp. ex phyllanthus marchionicus dhh07169a | AAS92299 AAS92299 |
1383360 |
| Epicephala sp. ex Phyllanthus marchionicus dhh071941a | Epicephala sp. ex phyllanthus marchionicus dhh071941a | AAS92299 AAS92299 |
1383361 |
| Epicephala sp. ex Phyllanthus marojejiensis | Epicephala sp. ex phyllanthus marojejiensis | ACL26933 ACL26933 |
586048 |
| Epicephala sp. ex Phyllanthus nadeaudii dhh09114d | Epicephala sp. ex phyllanthus nadeaudii dhh09114d | AAS92299 AAS92299 |
1383362 |
| Epicephala sp. ex Phyllanthus orohenense dhh08485a | Epicephala sp. ex phyllanthus orohenense dhh08485a | AGT36898 AGT36898 |
1383363 |
| Eriphia gonagra | Eriphia gonagra | ACB46939 ACB46939 |
504414 |
| Epicephala sp. ex Phyllanthus papenooense dhh08pape07a | Epicephala sp. ex phyllanthus papenooense dhh08pape07a | AGT36893 AGT36893 |
1383364 |
| Epicephala sp. ex Phyllanthus raiateaensis dhh073101a | Epicephala sp. ex phyllanthus raiateaensis dhh073101a | AGT36893 AGT36893 |
1383365 |
| Epicephala sp. ex Phyllanthus raivavense dhh08194b | Epicephala sp. ex phyllanthus raivavense dhh08194b | AGT36904 AGT36904 |
1383368 |
| Epicephala sp. ex Phyllanthus reticulatus | Epicephala sp. ex phyllanthus reticulatus | ACL26932 ACL26932 |
586049 |
| Epicephala sp. ex Phyllanthus samoanus neg5aa | Epicephala sp. ex phyllanthus samoanus neg5aa | AAS92299 AAS92299 |
1383369 |
| Epicephala sp. ex Phyllanthus sp. Kawakita 23 | Epicephala sp. ex phyllanthus sp. kawakita 23 | ACL26931 ACL26931 |
586551 |
| Epicephala sp. ex Phyllanthus sp. dhh08318a | Epicephala sp. ex phyllanthus sp. dhh08318a | AGT36893 AGT36893 |
1383370 |
| Epicephala sp. ex Phyllanthus sp. dhh08329a | Epicephala sp. ex phyllanthus sp. dhh08329a | AAS92299 AAS92299 |
1383371 |
| Epicephala sp. ex Phyllanthus sp. dhh10038a | Epicephala sp. ex phyllanthus sp. dhh10038a | AGT36911 AGT36911 |
1383373 |
| Epicephala sp. ex Phyllanthus sp. dhh10059a | Epicephala sp. ex phyllanthus sp. dhh10059a | AGT36913 AGT36913 |
1383376 |
| Epicephala sp. ex Phyllanthus sp. dhh10088a | Epicephala sp. ex phyllanthus sp. dhh10088a | AGT36912 AGT36912 |
1383377 |
| Epicephala sp. ex Phyllanthus sp. n. dhh08285a | Epicephala sp. ex phyllanthus sp. n. dhh08285a | AGT36915 AGT36915 |
1383378 |
| Epicephala sp. ex Phyllanthus st-johnii dhh07442a | Epicephala sp. ex phyllanthus st-johnii dhh07442a | AGT36899 AGT36899 |
1383379 |
| Epicephala sp. ex Phyllanthus st-johnii dhh07483a | Epicephala sp. ex phyllanthus st-johnii dhh07483a | AGT36902 AGT36902 |
1383380 |
| Epicephala sp. ex Phyllanthus taitensis dhh07411b | Epicephala sp. ex phyllanthus taitensis dhh07411b | AGT36897 AGT36897 |
1383381 |
| Epicephala sp. ex Phyllanthus temehaniensis dhh08030a | Epicephala sp. ex phyllanthus temehaniensis dhh08030a | AGT36901 AGT36901 |
1383382 |
| Epicephala sp. ex Phyllanthus temehaniensis dhh08443a | Epicephala sp. ex phyllanthus temehaniensis dhh08443a | AGT36907 AGT36907 |
1383383 |
| Epicephala sp. ex Phyllanthus tuamotuensis dhh08404a | Epicephala sp. ex phyllanthus tuamotuensis dhh08404a | AAS92299 AAS92299 |
1383384 |
| Epicephala sp. ex Phyllanthus ussuriensis | Epicephala sp. ex phyllanthus ussuriensis | ABC02946 ABC02946 |
586051 |
| Epicephala sp. ex Phyllanthus vulcani | Epicephala sp. ex phyllanthus vulcani | ACL26925 ACL26925 |
586052 |
| Epixanthus frontalis | Epixanthus frontalis | AIT97390 AIT97390 |
864873 |
| Eretmapodites quinquevittatus | Eretmapodites quinquevittatus | ADB80251 ADB80251 |
503352 |
| Eriocheir japonica | Japanese mitten crab | ADU87599 ADU87599 |
95603 |
| Eriocheir sinensis | Chinese mitten crab | Q9NH48 Q9NH48 |
95602 |
| Eriphia scabricula | Eriphia scabricula | AIT97391 AIT97391 |
1381943 |
| Eriphia smithii | Eriphia smithii | AIT97394 AIT97394 |
1442372 |
| Eteoryctis deversa | Eteoryctis deversa | ADJ53628 ADJ53628 |
797002 |
| Ethusa sexdentata | Ethusa sexdentata | AIT97392 AIT97392 |
547236 |
| Eucorethra underwoodi | Eucorethra underwoodi | ADB80269 ADB80269 |
33405 |
| Eucrate alcocki | Eucrate alcocki | AIT97386 AIT97386 |
1550541 |
| Eucrate crenata | Eucrate crenata | AIT97387 AIT97387 |
486106 |
| Eumetriochroa hederae | Eumetriochroa hederae | ADJ53634 ADJ53634 |
797004 |
| Eurypanopeus abbreviatus | Lobate mud crab | ACB46938 ACB46938 |
108109 |
| Eurytium limosum | Broadback mud crab | ACB46937 ACB46937 |
108121 |
| Fabia subquadrata | Fabia subquadrata | ACB46936 ACB46936 |
504422 |
| Fredilocarcinus apyratii | Fredilocarcinus apyratii | AIT97395 AIT97395 |
1550659 |
| Gaetice depressus | Gaetice depressus | AIT97398 AIT97398 |
156504 |
| Gecarcoidea lalandii | Gecarcoidea lalandii | AIT97400 AIT97400 |
364883 |
| Gecarcoidea natalis | Gecarcoidea natalis | AIT97400 AIT97400 |
45628 |
| Gibbovalva quadrifasciata | Gibbovalva quadrifasciata | ADJ53629 ADJ53629 |
271937 |
| Glyptograpsus jamaicensis | Glyptograpsus jamaicensis | AIT97399 AIT97399 |
151342 |
| Gomeza bicornis | Gomeza bicornis | AIT97374 AIT97374 |
1550661 |
| Gracillaria sp. RN-2016 | Gracillaria sp. rn-2016 | BAV44289 BAV44289 |
1806635 |
| Gracillaria syringella | Gracillaria syringella | ANT95730 ANT95730 |
753336 |
| Gracillaria ussuriella | Gracillaria ussuriella | BAV44289 BAV44289 |
1806627 |
| Gracillariidae gen. sp. 1 ex Mallotus philippensis | Gracillariidae gen. sp. 1 ex mallotus philippensis | ADJ53636 ADJ53636 |
796977 |
| Gracillariidae gen. sp. 2 ex Macaranga tanarius | Gracillariidae gen. sp. 2 ex macaranga tanarius | ADJ53579 ADJ53579 |
796978 |
| Gracillariidae gen. sp. 3 ex Sindora sp. | Gracillariidae gen. sp. 3 ex sindora sp. | ADJ53638 ADJ53638 |
796979 |
| Gracillariidae gen. sp. 4 ex Cassia sp. | Gracillariidae gen. sp. 4 ex cassia sp. | ADJ53579 ADJ53579 |
796980 |
| Gracillariidae gen. sp. 5 ex Caesalpinia crista | Gracillariidae gen. sp. 5 ex caesalpinia crista | ADJ53640 ADJ53640 |
796981 |
| Gracillariidae gen. sp. 6 ex Caesalpinia spiaria | Gracillariidae gen. sp. 6 ex caesalpinia spiaria | ADJ53641 ADJ53641 |
796982 |
| Gracillariidae gen. sp. 7 ex Elaeocarpus sylvestris | Gracillariidae gen. sp. 7 ex elaeocarpus sylvestris | ADJ53642 ADJ53642 |
796983 |
| Graphocephala atropunctata | Graphocephala atropunctata | ADF31832 JAT24238 JAT24904 JAT34482 ADF31832 JAT24238 JAT24904 JAT34482 |
36148 |
| Grapsus albolineatus | Grapsus albolineatus | AIT97368 AIT97368 |
156079 |
| Haemagogus equinus | Haemagogus equinus | ADB80252 ADB80252 |
53526 |
| Halyomorpha halys | Brown marmorated stink bug | XP_014280927 XP_014280926 XP_014280927 XP_014280926 |
286706 |
| Heikeopsis japonica | Heikeopsis japonica | AIT97403 AIT97403 |
255320 |
| Helicoverpa armigera | Cotton bollworm | ADD22718 ABU98622 ADD22718 ABU98622 |
29058 |
| Helicoverpa assulta | Helicoverpa assulta | ADD22718 ADD22718 |
52344 |
| Helicoverpa zea | Corn earworm | ADD22718 ADD22718 |
7113 |
| Heliothis virescens | Tobacco budworm | ADE27964 ADE27964 |
7102 |
| Hemigrapsus oregonensis | Hemigrapsus oregonensis | ACB46935 ACB46935 |
106767 |
| Heteropanope glabra | Heteropanope glabra | AIT97394 AIT97394 |
1550663 |
| Hippa adactyla | Hippa adactyla | ADU87565 ADU87565 |
941197 |
| Homalodisca liturata | Homalodisca liturata | AAT01074 JAS71005 JAS73081 JAS84655 JAS71622 AAT01074 JAS71005 JAS73081 JAS84655 JAS71622 |
320908 |
| Homalodisca vitripennis | Glassy-winged sharpshooter | AAT01074 AAT01074 |
197043 |
| Homarus gammarus | European lobster | P14208 P14208 |
6707 |
| Homola orientalis | Homola orientalis | AIT97406 AIT97406 |
1550542 |
| Hylaeus amiculus | Hylaeus amiculus | ABA62072 ABA62072 |
288351 |
| Hylaeus anthracinus | Hylaeus anthracinus | ABA62076 ABA62076 |
313031 |
| Hylaeus connectens | Hylaeus connectens | ABA62077 ABA62077 |
313035 |
| Hylaeus difficilis | Hylaeus difficilis | ABA62077 ABA62077 |
313037 |
| Hylaeus elegans | Hylaeus elegans | ABA62071 ABA62071 |
288352 |
| Hylaeus globula | Hylaeus globula | ABA62074 ABA62074 |
313027 |
| Hylaeus hula | Hylaeus hula | ABA62079 ABA62079 |
313048 |
| Hylaeus inquilina | Hylaeus inquilina | ABA62077 ABA62077 |
313050 |
| Hylaeus kauaiensis | Hylaeus kauaiensis | ABA62081 ABA62081 |
313051 |
| Hylaeus kokeensis | Hylaeus kokeensis | ABA62077 ABA62077 |
313052 |
| Hylaeus kona | Hylaeus kona | ABA62083 ABA62083 |
313053 |
| Hylaeus leptocephalus | Hylaeus leptocephalus | ABA62073 ABA62073 |
313017 |
| Hylaeus longiceps | Hylaeus longiceps | ABA62077 ABA62077 |
313057 |
| Hylaeus pele | Hylaeus pele | ABA62081 ABA62081 |
313065 |
| Hylaeus pubescens | Hylaeus pubescens | ABA62086 ABA62086 |
313067 |
| Hylaeus punctatus | Hylaeus punctatus | ABA62074 ABA62074 |
313026 |
| Hylaeus solaris | Hylaeus solaris | ABA62076 ABA62076 |
313069 |
| Hyposoter exiguae | Hyposoter exiguae | ABG35051 ABG35051 |
389683 |
| Hyposoter fugitivus | Hyposoter fugitivus | ABG35053 ABG35053 |
389684 |
| Inurois brunneus | Inurois brunneus | BAK95903 BAK95903 |
749356 |
| Inurois fletcheri | Inurois fletcheri | BAK95903 BAK95903 |
393384 |
| Inurois fumosa | Inurois fumosa | BAK95903 BAK95903 |
570122 |
| Inurois membranaria | Inurois membranaria | BAK95903 BAK95903 |
393385 |
| Inurois nikkoensis | Inurois nikkoensis | BAK95903 BAK95903 |
570125 |
| Inurois punctigera | Inurois punctigera | BAK95903 BAK95903 |
570447 |
| Inurois sp. F1287_sp | Inurois sp. f1287_sp | BAK95903 BAK95903 |
749357 |
| Inurois sp. F1288_sp | Inurois sp. f1288_sp | BAK95903 BAK95903 |
749358 |
| Inurois sp. F1289_sp | Inurois sp. f1289_sp | BAK95903 BAK95903 |
749359 |
| Inurois sp. F1291_sp | Inurois sp. f1291_sp | BAK95903 BAK95903 |
749360 |
| Inurois sp. F1292_sp | Inurois sp. f1292_sp | BAK95903 BAK95903 |
749361 |
| Inurois tenuis | Inurois tenuis | BAK95903 BAK95903 |
570126 |
| Inurois viidaleppi | Inurois viidaleppi | BAK95903 BAK95903 |
749362 |
| Jonas distinctus | Jonas distinctus | AIT97408 AIT97408 |
1550543 |
| Metopograpsus frontalis | Metopograpsus frontalis | AIT97423 AIT97423 |
1036996 |
| Laccodytes sp. UNM KBMLmsp764 | Laccodytes sp. unm kbmlmsp764 | AJG04988 AJG04988 |
1606460 |
| Laccodytes sp. UNM KBMLysp376 | Laccodytes sp. unm kbmlysp376 | AJG05039 AJG05039 |
1606461 |
| Lamoha longirostris | Lamoha longirostris | AIT97413 AIT97413 |
1550665 |
| Lewindromia unidentata | Lewindromia unidentata | AIT97416 AIT97416 |
1550668 |
| Limatus durhamii | Limatus durhamii | ADB80253 ADB80253 |
704165 |
| Liocrobyla desmodiella | Liocrobyla desmodiella | ADJ53619 ADJ53619 |
796992 |
| Loxorhynchus crispatus | Loxorhynchus crispatus | ACB46933 ACB46933 |
504426 |
| Lybia tessellata | Lybia tessellata | AIT97415 AIT97415 |
903642 |
| Lydia annulipes | Lydia annulipes | AIT97390 AIT97390 |
864883 |
| Lyreidus tridentatus | Lyreidus tridentatus | AIT97417 AIT97417 |
1550544 |
| Macrophthalmus definitus | Macrophthalmus definitus | AIT97419 AIT97419 |
220125 |
| Macrophthalmus erato | Macrophthalmus erato | AIT97387 AIT97387 |
220131 |
| Macrophthalmus japonicus | Macrophthalmus japonicus | AID47194 AID47194 |
138195 |
| Malaya genurostris | Malaya genurostris | ADB80254 ADB80254 |
325434 |
| Mamestra configurata | Bertha armyworm | AEA76312 AEA76312 |
174822 |
| Maorigoeldia argyropus | Maorigoeldia argyropus | ADB80255 ADB80255 |
704167 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | P51545 P51545 |
27405 |
| Mathildella rubra | Mathildella rubra | AIT97429 AIT97429 |
1550670 |
| Matuta planipes | Matuta planipes | AIT97427 AIT97427 |
1235672 |
| Melanocercops ficuvorella | Melanocercops ficuvorella | ACL26940 ACL26940 |
586056 |
| Menippe adina | Gulf stone crab | ACB46931 ACB46931 |
38149 |
| Menippe mercenaria | Florida stone crab | ACB46931 ACB46931 |
6781 |
| Menippe rumphii | Menippe rumphii | AIT97421 AIT97421 |
864863 |
| Metacarcinus magister | Dungeness crab | ACB46941 AIT97426 ACB46941 AIT97426 |
29965 |
| Metadynomene tanensis | Metadynomene tanensis | AIT97430 AIT97430 |
405141 |
| Metaplax longipes | Metaplax longipes | AIT97382 AIT97382 |
1550546 |
| Metaxina ornata | Metaxina ornata | ANW43959 ANW43959 |
1718906 |
| Metopograpsus quadridentatus | Metopograpsus quadridentatus | AIT97428 AIT97428 |
331402 |
| Michelopagurus limatulus | Michelopagurus limatulus | ADU87571 ADU87571 |
941216 |
| Microphrys bicornutus | Microphrys bicornutus | ACB46930 ACB46930 |
504427 |
| Mictyris brevidactylus | Mictyris brevidactylus | AIT97418 AIT97418 |
78113 |
| Mimomyia luzonensis | Mimomyia luzonensis | ADB80256 ADB80256 |
704170 |
| Mithraculus coryphe | Mithraculus coryphe | AIT97424 AIT97424 |
765933 |
| Mithraculus forceps | Mithraculus forceps | ACB46928 ACB46928 |
504428 |
| Mithraculus sculptus | Mithraculus sculptus | ACB46929 ACB46929 |
504429 |
| Mythimna separata | Northern armyworm | ALK82255 ALK82255 |
271217 |
| Nasonia vitripennis | Jewel wasp | XP_016845331 XP_016845331 |
7425 |
| Neocaridina denticulata | Japanese swamp shrimp | BAH56609 BAH56609 |
274642 |
| Neohelice granulata | Neohelice granulata | AAF43438 AAF43438 |
53323 |
| Neopetrolisthes maculatus | Porcelain anemone crab | ADU87574 ADU87574 |
941218 |
| Nepinnotheres cf. affinis LMT-2014 | Nepinnotheres cf. affinis lmt-2014 | AIT97364 AIT97364 |
1550561 |
| Novactaea bella | Novactaea bella | AIT97433 AIT97433 |
903761 |
| Novorostrum indicum | Novorostrum indicum | ADU87575 ADU87575 |
941220 |
| Ochlerotatus triseriatus | Ochlerotatus triseriatus | ADB80257 ADB80257 |
7162 |
| Ocypode ceratophthalmus | Ocypode ceratophthalmus | AIT97437 AIT97437 |
373423 |
| Ocypode sinensis | Ocypode sinensis | AIT97437 AIT97437 |
1236104 |
| Oedignathus inermis | Oedignathus inermis | ACB46949 ACB46949 |
6743 |
| Operophtera brumata | Winter moth | KOB78348 KOB78348 |
104452 |
| Opifex fuscus | Opifex fuscus | ADB80258 ADB80258 |
704161 |
| Orithyia sinica | Orithyia sinica | AIT97441 AIT97441 |
260260 |
| Orthopodomyia alba | Orthopodomyia alba | ADB80254 ADB80254 |
139054 |
| Pugettia nipponensis | Pugettia nipponensis | AIT97466 AIT97466 |
516928 |
| Ostrinia furnacalis | Asian corn borer | AIY31784 AIX48027 AIY31784 AIX48027 |
93504 |
| Ovalipes punctatus | Ovalipes punctatus | AIT97439 AIT97439 |
331408 |
| Ozius rugulosus | Ozius rugulosus | AIT97394 AIT97394 |
1460405 |
| Pachygrapsus crassipes | Pachygrapsus crassipes | ACB46926 ACB46926 |
307936 |
| Pachygrapsus gracilis | Pachygrapsus gracilis | ACB46927 ACB46927 |
504416 |
| Pachygrapsus marmoratus | Marbled crab | Q9GYX1 Q9GYX1 |
135190 |
| Pachygrapsus plicatus | Pachygrapsus plicatus | AIT97443 AIT97443 |
1037002 |
| Pagurodofleinia doederleini | Pagurodofleinia doederleini | ADU87581 ADU87581 |
516922 |
| Pagurus angustus | Pagurus angustus | ADU87578 ADU87578 |
941200 |
| Pagurus bernhardus | Common hermit crab | ADU87580 ADU87580 |
174397 |
| Palapedia cf. nitida LMT-2014 | Palapedia cf. nitida lmt-2014 | AIT97446 AIT97446 |
1562296 |
| Panopeus obesus | Saltmarch mud crab | ACB46925 ACB46925 |
108102 |
| Papilio machaon | Common yellow swallowtail | KPJ11986 XP_014362614 XP_014362613 KPJ11986 XP_014362614 XP_014362613 |
76193 |
| Papilio polytes | Papilio polytes | NP_001298459 XP_013133259 XP_013133258 XP_013133257 XP_013133256 NP_001298459 XP_013133259 XP_013133258 XP_013133257 XP_013133256 |
76194 |
| Papilio xuthus | Papilio xuthus | NP_001299545 XP_013176660 XP_013176659 XP_013176658 NP_001299545 XP_013176660 XP_013176659 XP_013176658 |
66420 |
| Parasesarma affine | Parasesarma affine | AIT97460 AIT97460 |
1550548 |
| Parathranites orientalis | Parathranites orientalis | AIT97457 AIT97457 |
1550549 |
| Paromolopsis boasi | Paromolopsis boasi | AIT97448 AIT97448 |
1550674 |
| Parthenope longimanus | Parthenope longimanus | AIT97445 AIT97445 |
1550550 |
| Pediculus humanus corporis | Human body louse | XP_002433179 XP_002433179 |
121224 |
| Pugettia producta | Pugettia producta | ACB46922 ACB46922 |
504418 |
| Penaeus monodon | Black tiger shrimp | AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 |
6687 |
| Percnon affine | Percnon affine | AIT97450 AIT97450 |
1550551 |
| Percnon planissimum | Percnon planissimum | AIT97461 AIT97461 |
364891 |
| Perisesarma bidens | Perisesarma bidens | AIT97447 AIT97447 |
156088 |
| Petrolisthes japonicus | Petrolisthes japonicus | ADU87587 ADU87587 |
516895 |
| Philippicarcinus oviformis | Philippicarcinus oviformis | AIT97453 AIT97453 |
652069 |
| Pilumnus longicornis | Pilumnus longicornis | AIT97394 AIT97394 |
1550552 |
| Pilumnus vespertilio | Pilumnus vespertilio | AIT97467 AIT97467 |
652054 |
| Pitho lherminieri | Pitho lherminieri | ACB46924 ACB46924 |
504434 |
| Plagusia squamosa | Plagusia squamosa | AIT97382 AIT97382 |
157785 |
| Platychirograpsus spectabilis | Platychirograpsus spectabilis | AIT97463 AIT97463 |
106764 |
| Platypus curtus | Platypus curtus | AKS50037 AKS50037 |
1689900 |
| Platypus sp. PlPla08 | Platypus sp. plpla08 | AKS50028 AKS50028 |
1690099 |
| Plodia interpunctella | Indianmeal moth | Q95PM9 Q95PM9 |
58824 |
| Plutella xylostella | Diamondback moth | XP_011559790 NP_001292442 XP_011559789 XP_011559787 XP_011559786 XP_011559790 NP_001292442 XP_011559789 XP_011559787 XP_011559786 |
51655 |
| Poecilocampa populi | Poecilocampa populi | ANT95748 ANT95748 |
475346 |
| Portunus pelagicus | Sand crab | AIT97455 AIT97455 |
80836 |
| Portunus sp. 1 BCM-2008 | Portunus sp. 1 bcm-2008 | ACB46923 ACB46923 |
504417 |
| Portunus trituberculatus | Swimming crab | ADO22720 AEZ68730 AEZ68729 AEZ68724 AEZ68722 ADO22731 ADO22728 ADO22727 ADO22722 ADO22721 ADO22719 ADO22718 ADO22717 ADO22716 ADO22715 ADN88105 ADO22720 AEZ68730 AEZ68729 AEZ68724 AEZ68722 ADO22731 ADO22728 ADO22727 ADO22722 ADO22721 ADO22719 ADO22718 ADO22717 ADO22716 ADO22715 ADN88105 |
210409 |
| Propagurus obtusifrons | Propagurus obtusifrons | ADU87588 ADU87588 |
516926 |
| Pseudocarcinus gigas | Pseudocarcinus gigas | AIT97452 AIT97452 |
205354 |
| Psorophora ferox | Psorophora ferox | ADB80260 ADB80260 |
7183 |
| Psydrocercops wisteriae | Psydrocercops wisteriae | ADJ53631 ADJ53631 |
797010 |
| Pteromalus puparum | Pteromalus puparum | ACZ68114 ACZ68114 |
32389 |
| Pugettia sp. LMT-2014 | Pugettia sp. lmt-2014 | AIT97402 AIT97402 |
1550562 |
| Pyralis farinalis | Pyralis farinalis | ANT95734 ANT95734 |
687122 |
| Pyrgus malvae | Grizzled skipper | ANT95732 ANT95732 |
218760 |
| Pyrhila carinata | Pyrhila carinata | AIT97449 AIT97449 |
1550647 |
| Retropluma denticulata | Retropluma denticulata | AIT97468 AIT97468 |
1550680 |
| Rhetus periander | Rhetus periander | ANJ59731 ANJ59731 |
929583 |
| Rhinopithecus roxellana | Golden snub-nosed monkey | XP_010386033 XP_010386033 |
61622 |
| Riodina lycisca | Riodina lycisca | ANJ59732 ANJ59732 |
1859608 |
| Sabethes cyaneus | Sabethes cyaneus | ADB80261 ADB80261 |
53552 |
| Scalopidia spinosipes | Scalopidia spinosipes | AIT97475 AIT97475 |
1550682 |
| Scolytomimus philippinensis | Scolytomimus philippinensis | AFP75471 AFP75471 |
1220332 |
| Scopimera intermedia | Scopimera intermedia | AIT97382 AIT97382 |
664711 |
| Scopimera proxima | Scopimera proxima | AIT97382 AIT97382 |
1550554 |
| Scylla olivacea | Orange mud crab | ACP43443 ACP43443 |
85551 |
| Scylla paramamosain | Green mud crab | AIT97471 AFG28553 AFK25805 AFA45340 AEY84969 AIT97471 AFG28553 AFK25805 AFA45340 AEY84969 |
85552 |
| Scylla serrata | Giant mud crab | ACV96855 ACV96855 |
6761 |
| Scyra acutifrons | Scyra acutifrons | ACB46921 ACB46921 |
504435 |
| Sesarma reticulatum | Heavy marsh crab | ACB46920 ACB46920 |
39558 |
| Shannoniana fluviatilis | Shannoniana fluviatilis | ADB80262 ADB80262 |
704169 |
| Shinkaia crosnieri | Shinkaia crosnieri | ADU87590 ADU87590 |
480484 |
| Sinophorus townesorum | Sinophorus townesorum | ABG35057 ABG35057 |
389714 |
| Spiropagurus profundorum | Spiropagurus profundorum | ADU87591 ADU87591 |
941225 |
| Spodoptera exigua | Beet armyworm | ACU68932 ACU68932 |
7107 |
| Spodoptera frugiperda | Fall armyworm | AGH14259 AGH14259 |
7108 |
| Spodoptera litura | Spodoptera litura | ADW94627 ADW94627 |
69820 |
| Stomphastis chalybacma | Stomphastis chalybacma | ADJ53620 ADJ53620 |
859246 |
| Stomphastis labyrinthica | Stomphastis labyrinthica | ACL26939 ACL26939 |
586058 |
| Streptocranus longispinis | Streptocranus longispinis | AEE10344 AEE10344 |
995706 |
| Taleporia tubulosa | Taleporia tubulosa | ANT95746 ANT95746 |
753433 |
| Thalamita prymna | Thalamita prymna | AIT97480 AIT97480 |
292273 |
| Thyatira batis | Thyatira batis | ANT95729 ANT95729 |
721163 |
| Tiarinia sp. LMT-2014 | Tiarinia sp. lmt-2014 | AIT97478 AIT97478 |
1550564 |
| Tischeria ekebladella | Tischeria ekebladella | ANT95744 ANT95744 |
683971 |
| Tmethypocoelis ceratophora | Tmethypocoelis ceratophora | AIT97382 AIT97382 |
78110 |
| Tokoyo eburnea | Tokoyo eburnea | AIT97387 AIT97387 |
516934 |
| Tortrix viridana | Green oak leaf roller | ANT95741 ANT95741 |
311328 |
| Toxorhynchites amboinensis | Toxorhynchites amboinensis | ADB80263 ADB80263 |
46208 |
| Tranosema rostrale | Tranosema rostrale | ABG35048 ABG35048 |
192605 |
| Trapezia septata | Trapezia septata | AIT97481 AIT97481 |
1550555 |
| Trapezia tigrina | Trapezia tigrina | AIT97481 AIT97481 |
652056 |
| Trichogramma pretiosum | Trichogramma pretiosum | XP_014237695 XP_014237694 XP_014237693 XP_014237695 XP_014237694 XP_014237693 |
7493 |
| Trichoprosopon digitatum | Trichoprosopon digitatum | ADB80264 ADB80264 |
704163 |
| Trizocheles brachyops | Trizocheles brachyops | ADU87594 ADU87594 |
941205 |
| Trizocheles sakaii | Trizocheles sakaii | ADU87595 ADU87595 |
941206 |
| Uca borealis | Uca borealis | AIT97483 AIT97483 |
626958 |
| Uca crassipes | Uca crassipes | AIT97484 AIT97484 |
399438 |
| Uca lactea | Uca lactea | AIT97485 AIT97485 |
78088 |
| Uca longisignalis | Uca longisignalis | ACB46917 ACB46917 |
504419 |
| Uca minax | Uca minax | ACB46918 ACB46918 |
504420 |
| Uca pugilator | Atlantic sand fiddler crab | ACB46917 ACB46917 |
6772 |
| Uranotaenia sapphirina | Uranotaenia sapphirina | ADB80266 ADB80266 |
139056 |
| Valdivia serrata | Valdivia serrata | AIT97488 AIT97488 |
1425196 |
| Venturia canescens | Venturia canescens | ABG35048 ABG35048 |
32260 |
| Wockia asperipunctella | Wockia asperipunctella | ANT95728 ANT95728 |
534398 |
| Wyeomyia smithii | Pitcher-plant mosquito | ADB80267 ADB80267 |
174621 |
| Xantho pilipes | Xantho pilipes | AIT97489 AIT97489 |
342076 |
| Yponomeuta evonymellus | Bird-cherry ermine moth | ANT95738 ANT95738 |
263930 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.