If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: HALMTWGDK
Peptide within the protein Pen-m-3:
SRKSGSRSSSKRSKKSGGGSNVFDMFTQRQVAEFKEGFQLMDRDKDGVIGKTDLRGTFDEIGRIATDQELDEMLADAPAPINFTMLLNMFAERQTGESDDDDVVAKAFLAFADEGGNIDCDTFRHALMTWGDKFSSQEADDALDQMDIDDAGKIDVQSVIQMLTAGGGDDAAAEEA
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Lit-v-3.0101 | 6689 |
| Shrimp | Pen-m-3.0101 | 6687 |
Species containing the peptide HALMTWGDK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Amyelois transitella | Amyelois transitella | XP_013196134 XP_013196134 |
680683 |
| Antheraea pernyi | Chinese oak silkmoth | ADL09420 ADL09420 |
7119 |
| Orchesella cincta | Orchesella cincta | ODN01919 ODN01919 |
48709 |
| Artemia franciscana | Artemia franciscana | ABY62750 ABN13578 ABS19976 ABY62750 ABN13578 ABS19976 |
6661 |
| Blattella germanica | German cockroach | ABD47458 AEV53595 ABD47458 AEV53595 |
6973 |
| Bombyx mandarina | Wild silkworm | NP_001091813 NP_001091813 |
7092 |
| Bombyx mori | Domestic silkworm | NP_001091813 NP_001091813 |
7091 |
| Camponotus floridanus | Florida carpenter ant | XP_011252449 EFN70893 XP_011252449 EFN70893 |
104421 |
| Cephus cinctus | Wheat stem sawfly | XP_015597215 XP_015597215 |
211228 |
| Cerapachys biroi | Cerapachys biroi | XP_011342572 XP_011342572 |
443821 |
| Danaus plexippus | Monarch butterfly | EHJ75770 EHJ75770 |
13037 |
| Dendroctonus ponderosae | Mountain pine beetle | AEE62806 AEE62806 |
77166 |
| Dinoponera quadriceps | Dinoponera quadriceps | XP_014488532 XP_014488532 |
609295 |
| Euphaea decorata | Euphaea decorata | AFG33697 AFG33697 |
543827 |
| Euphaea formosa | Euphaea formosa | AFG33669 AFG33655 AFG33669 AFG33655 |
476664 |
| Euphaea ornata | Euphaea ornata | AFG33735 AFG33697 AFG33735 AFG33697 |
1129045 |
| Euphaea yayeyamana | Euphaea yayeyamana | AFG33655 AFG33655 |
543830 |
| Gryllotalpa orientalis | Oriental mole cricket | AAW22542 AAW22542 |
213494 |
| Harpegnathos saltator | Jerdon's jumping ant | EFN88243 XP_011154223 EFN88243 XP_011154223 |
610380 |
| Hyalella azteca | Hyalella azteca | XP_018020312 XP_018020312 |
294128 |
| Litopenaeus vannamei | Pacific white shrimp | ACC76803 ACC76803 |
6689 |
| Lonomia obliqua | Lonomia obliqua | AAV91413 AAV91413 |
304329 |
| Monomorium pharaonis | Pharaoh ant | XP_012534266 XP_012534266 |
307658 |
| Nicrophorus vespilloides | Nicrophorus vespilloides | XP_017771116 XP_017770518 XP_017771116 XP_017770518 |
110193 |
| Nilaparvata lugens | Brown planthopper | AGI96977 AGI96977 |
108931 |
| Operophtera brumata | Winter moth | KOB70662 KOB70662 |
104452 |
| Papilio machaon | Common yellow swallowtail | XP_014362394 KPJ12106 XP_014362394 KPJ12106 |
76193 |
| Papilio polytes | Papilio polytes | NP_001298584 NP_001298584 |
76194 |
| Papilio xuthus | Papilio xuthus | NP_001298816 KPJ02965 NP_001298816 KPJ02965 |
66420 |
| Pediculus humanus corporis | Human body louse | XP_002425950 XP_002425950 |
121224 |
| Penaeus monodon | Black tiger shrimp | ADM34185 ADV17342 ADM34185 ADV17342 |
6687 |
| Periplaneta americana | American cockroach | AEV23878 AEZ35213 AEV23879 AEV23878 AEZ35213 AEV23879 |
6978 |
| Pogonomyrmex barbatus | Red harvester ant | XP_011646930 XP_011646930 |
144034 |
| Polistes canadensis | Polistes canadensis | XP_014614179 XP_014614179 |
91411 |
| Polistes dominula | Polistes dominula | XP_015190708 XP_015190708 |
743375 |
| Solenopsis invicta | Red fire ant | EFZ17125 XP_011161500 EFZ17125 XP_011161500 |
13686 |
| Tribolium castaneum | Red flour beetle | XP_008198303 XP_008198303 |
7070 |
| Zootermopsis nevadensis | Zootermopsis nevadensis | KDR10217 KDR10217 |
136037 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.