If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Black-tiger-shrimp Protein: Pen m 4 | Sarcoplasmic Calcium Binding Protein

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 193 amino acids

MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ

UniProt: E7CGC4   IUIS: Pen m 4

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
^ MAYSWDNR V 0 0.31 0.14036
R YMYDIDNNGFLDK N 0 0.544 0.2747
K NDFECLAVR N 0 0.482 0.43732
R NTLIEGR G 0 0.268 0.22318
R GEFSADAYANNQK I 0 0.534 0.49476
R NLWNEIAELADFNK D 0 0.593 0.43648
K DGEVTVDEFK Q 0 0.41 0.602
K YGDFPGAFK V 0 0.495 0.4116
K VFIANQFK A 0 0.363 0.27084
K AIDVNGDGK V 0 0.281 0.3898
K VGLDEYR L 0 0.267 0.3523
R SAFAEVK E 0 0.218 0.19356
K EIDDAYNK L 0 0.257 0.23824
K LTTEDDR K 0 0.229 0.11912
K AGGLTLER Y 0 0.28 0.45292
R YQDLYAQFISNPDESCSACYLFGPLK V 0 0.42 0.04198

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.