Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
MAKFLLLLSAFAVLLLVANASIYRAIVEVEEDSGREQSCQRQFEEQQRFRNCQRYVKQEVQRGGRYNQRQESLRECCQELQEVDRRCRCQNLEQMVRQLQQQEQIKGEEVRELYETASELPRICSISPSQGCQFQSSY
UniProt: Q8H2B8 IUIS: Ana o 3Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | FLLLLSAFAVLLLVANASIYR | A | 0 | 0.172 | 0.1383 |
| R | AIVEVEEDSGR | E | 0 | 0.42 | 0.6929 |
| R | QFEEQQR | F | 0 | 0.234 | 0.18844 |
| R | ECCQELQEVDR | R | 0 | 0.446 | 0.36948 |
| R | CQNLEQMVR | Q | 0 | 0.275 | 0.3376 |
| R | QLQQQEQIK | G | 1 | 0.256 | 0.38306 |
| R | ELYETASELPR | I | 2 | 0.597 | 0.77794 |
| R | ICSISPSQGCQFQSSY | $ | 0 | 0.372 | 0.27934 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.