If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

  1. Home
  2. Celery
  3. Api g 1

Celery Protein: Api g 1 | Pathogenesis-Related Protein, Pr-10, Bet V 1 Family Member

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 154 amino acids

MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

UniProt: P49372   IUIS: Api g 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 159 amino acids

MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

UniProt: P92918   IUIS: Api g 1

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1 Peptide 2 Exp.3 ESP4 CONSeQ5
^ MGVQTHVLELTSSVSAEK I 0 0.6 0.33422
K IFQGFVIDVDTVLPK A 0 0.707 0.18912
K AAPGAYK S 0 0.209 0.13774
K GDGGPGTLK I 0 0.214 0.23698
K IITLPDGGPITTMTLR I 0 0.703 0.55068
K TTAIFHTK G 0 0.303 0.28988
K GDAVVPEENIK Y 0 0.529 0.87558
K YANEQNTALFK A 0 0.495 0.62582
K ALEAYLIAN $ 0 0.262 0.3859
K TVVEAPSTVSAEK M 0 0.66 0.71098
K MYQGFLLDMDTVFPK V 0 0.586 0.05556
K VLPQLIK S 0 0.282 0.29546
K SVEILEGDGGVGTVK L 0 0.639 0.68604
K LVHLGEATEYTTMK Q 0 0.582 0.39682
K NTTIYNTK G 0 0.242 0.28334
K GDAVLPEDK I 0 0.281 0.50576
K AVEAYLLANLQFLA $ 0 0.443 0.26124

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.

 

  1. Home
  2. Celery
  3. Api g 1