Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NTTIYNTK
Peptide within the protein Api-g-1:
MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NTTIYNTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Apium graveolens | Apium graveolens | P92918 |
4045 |
| Daucus carota | Carrot | XP_017234488 |
4039 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | XP_017234488 |
79200 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.