Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TTAIFHTK
Peptide within the protein Api-g-1:
MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TTAIFHTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Apium graveolens | Apium graveolens | P49372 |
4045 |
| Daucus carota | Carrot | BAB88129 BAA13604 O04298 ADL32666 ADL32665 ADL32664 ADL32663 ADL32662 ADL32661 ADL32660 2WQL_A CAB03716 T14301 |
4039 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | KZM85546 XP_017222117 XP_017222096 XP_017222118 XP_017216508 XP_017216650 XP_017222116 XP_017222115 |
79200 |
| Pimpinella brachycarpa | Pimpinella brachycarpa | AAC31957 |
45043 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.