Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VLPQLIK
Peptide within the protein Api-g-1:
MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VLPQLIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Xenopus (Silurana) tropicalis | Western clawed frog | OCA21760 |
8364 |
| Apium graveolens | Apium graveolens | P92918 |
4045 |
| Astyanax mexicanus | Mexican tetra | XP_007247402 |
7994 |
| Colletotrichum fioriniae PJ7 | Colletotrichum fioriniae pj7 | XP_007602084 |
1445577 |
| Colletotrichum nymphaeae SA-01 | Colletotrichum nymphaeae sa-01 | KXH55203 |
1460502 |
| Colletotrichum simmondsii | Colletotrichum simmondsii | KXH27721 |
703756 |
| Daucus carota | Carrot | XP_017234488 |
4039 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | XP_017234488 |
79200 |
| Dictyostelium purpureum | Dictyostelium purpureum | XP_003292510 |
5786 |
| Diuraphis noxia | Russian wheat aphid | XP_015374219 XP_015374218 |
143948 |
| Eufriesea mexicana | Eufriesea mexicana | XP_017759348 |
516756 |
| Exophiala dermatitidis NIH/UT8656 | Exophiala dermatitidis nih/ut8656 | XP_009152436 |
858893 |
| Glycine max | Soybean | XP_014626138 |
3847 |
| Hanseniaspora valbyensis NRRL Y-1626 | Hanseniaspora valbyensis nrrl y-1626 | OBA25577 |
766949 |
| Mixia osmundae IAM 14324 | Mixia osmundae iam 14324 | XP_014567751 |
764103 |
| Naegleria gruberi | Naegleria gruberi | XP_002675776 |
5762 |
| Naegleria gruberi strain NEG-M | Naegleria gruberi strain neg-m | XP_002675776 |
744533 |
| Plutella xylostella | Diamondback moth | XP_011554387 |
51655 |
| Pseudocohnilembus persalinus | Pseudocohnilembus persalinus | KRX04146 |
266149 |
| Saccoglossus kowalevskii | Saccoglossus kowalevskii | XP_006817162 |
10224 |
| Scleroderma citrinum Foug A | Scleroderma citrinum foug a | KIM60233 |
1036808 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016310121 XP_016310120 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016102364 XP_016102361 |
75366 |
| Vitis vinifera | Wine grape | XP_010661282 CBI34745 XP_010661277 XP_010661272 |
29760 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.