Celery Protein: Api g 2 | Non-Specific Lipid-Transfer Protein, Type 1

Cart: 0

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.

Sequence - 118 amino acids

MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRVN

UniProt: E6Y8S8 IUIS: Api g 2

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:

Cysteine

Methionine

NXS / NXT

RP / KP

RR / KK / KR / RK

Nonspecific

Peptide Characteristics:

Minimum length:

Maximum length:

1	Peptide	2	ESP⁴	CONSeQ⁵
K	LGGCLGYLK	G	0.276	0.39574
K	GGGYPSPACCGGVK	G	0.532	0.32944
K	GLNSLAK	T	0.216	0.11346
K	QACACLK	T	0.271	0.20986
K	TLAGSVK	G	0.203	0.11852
K	GINYGAASALPGK	C	0.562	0.7103
R	IPYPISPSTDCSR	V	0.614	0.43322

¹ Previous amino acid (^ = Start of protein)

² Next amino acid ($ = End of protein)

³ Exp. = Number of publications in which this peptide has been reported experimentally

⁴ ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

⁵ CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.