If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GLNSLAK
Peptide within the protein Api-g-2:
MGVSKVAIAVAVMLMVVVINHPAVVEGLTCGQVTGKLGGCLGYLKGGGYPSPACCGGVKGLNSLAKTPADRKQACACLKTLAGSVKGINYGAASALPGKCGIRIPYPISPSTDCSRVN
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GLNSLAK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Amphimedon queenslandica | Amphimedon queenslandica | XP_003382712 |
400682 |
| Anolis carolinensis | Green anole | XP_008108003 |
28377 |
| Apium graveolens | Apium graveolens | E6Y8S8 |
4045 |
| Aplysia californica | California sea hare | XP_005105731 |
6500 |
| Beta vulgaris subsp. vulgaris | Sugar beet | XP_010696425 |
3555 |
| Clastoptera arizonana | Arizona spittle bug | JAS12306 |
38151 |
| Coffea canephora | Coffea canephora | CDP21222 CDP20945 CDP07823 CDP20074 CDP20963 CDP04904 |
49390 |
| Corvus brachyrhynchos | American crow | XP_008627211 KFO55562 |
85066 |
| Corvus cornix cornix | Corvus cornix cornix | XP_008627211 |
932674 |
| Cylindrobasidium torrendii FP15055 ss-10 | Cylindrobasidium torrendii fp15055 ss-10 | KIY72939 |
1314674 |
| Daucus carota subsp. sativus | Daucus carota subsp. sativus | KZM91758 XP_017258831 |
79200 |
| Dendroctonus ponderosae | Mountain pine beetle | ENN77904 ERL83637 |
77166 |
| Eimeria mitis | Eimeria mitis | XP_013350552 |
44415 |
| Geospiza fortis | Medium ground-finch | XP_005418853 |
48883 |
| Guillardia theta CCMP2712 | Guillardia theta ccmp2712 | XP_005830159 |
905079 |
| Hadesarchaea archaeon YNP_45 | Hadesarchaea archaeon ynp_45 | KUO41428 |
1776334 |
| Ictalurus punctatus | Channel catfish | XP_017341539 |
7998 |
| Lachancea sp. KF-2015 | Lachancea sp. kf-2015 | CUS23028 |
1654605 |
| Lachancea thermotolerans CBS 6340 | Lachancea thermotolerans cbs 6340 | XP_002555908 |
559295 |
| Nannochloropsis gaditana | Nannochloropsis gaditana | EWM28885 |
72520 |
| Neodiprion lecontei | Redheaded pine sawfly | XP_015515110 |
441921 |
| Neolamprologus brichardi | Neolamprologus brichardi | XP_006780829 |
32507 |
| Perkinsus marinus ATCC 50983 | Perkinsus marinus atcc 50983 | XP_002784603 |
423536 |
| Pestalotiopsis fici W106-1 | Pestalotiopsis fici w106-1 | XP_007828417 |
1229662 |
| Protobothrops mucrosquamatus | Protobothrops mucrosquamatus | XP_015687821 |
103944 |
| Rhagoletis zephyria | Snowberry fruit fly | XP_017486368 |
28612 |
| Schistosoma mansoni | Schistosoma mansoni | CCD77957 |
6183 |
| Serinus canaria | Common canary | XP_009089783 |
9135 |
| Strongyloides ratti | Strongyloides ratti | CEF60997 |
34506 |
| Taeniopygia guttata | Zebra finch | XP_002196553 |
59729 |
| Trametes cinnabarina | Trametes cinnabarina | CDO75182 |
5643 |
| Zonotrichia albicollis | White-throated sparrow | XP_014126683 XP_005492942 |
44394 |
| Zootermopsis nevadensis | Zootermopsis nevadensis | KDR22892 |
136037 |
| uncultured marine group II/III euryarchaeote AD1000_105_G07 | Uncultured marine group ii/iii euryarchaeote ad1000_105_g07 | AIE91079 |
1457714 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.