If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: EQKPCLCGYLK
Peptide within the protein Api-g-6:
ATCSAVQLSPCLAAITKNTPPSAACCNKLKEQKPCLCGYLKDPNLKNYVNSPGARKTASSCGVALKC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide EQKPCLCGYLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Vigna angularis var. angularis | Vigna angularis var. angularis | BAT83007 |
157739 |
| Vigna radiata var. radiata | Mung bean | XP_014497762 |
3916 |
| Vitis vinifera | Wine grape | XP_003633726 |
29760 |
| Apium graveolens Rapaceum Group | Apium graveolens rapaceum group | P86809 |
278110 |
| Cleome hassleriana | Cleome hassleriana | XP_010534224 |
28532 |
| Cucumis melo | Muskmelon | XP_008453433 |
3656 |
| Cucumis sativus | Cucumber | XP_011648973 |
3659 |
| Jatropha curcas | Jatropha curcas | KDP32977 XP_012078002 |
180498 |
| Nicotiana sylvestris | Wood tobacco | XP_009777694 |
4096 |
| Nicotiana tabacum | Common tobacco | XP_016480559 |
4097 |
| Nicotiana tomentosiformis | Nicotiana tomentosiformis | XP_009626576 |
4098 |
| Populus euphratica | Populus euphratica | XP_011035101 XP_011021288 |
75702 |
| Populus trichocarpa | Black cottonwood | XP_002305838 XP_006383409 |
3694 |
| Prunus mume | Japanese apricot | XP_008229268 |
102107 |
| Solanum lycopersicum | Tomato | XP_004234577 |
4081 |
| Solanum pennellii | Solanum pennellii | XP_015067984 |
28526 |
| Vigna angularis | Adzuki bean | XP_017408957 |
3914 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.