Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Chum salmon Protein: Onc k 5 | β-Prime-Component Of Vitellogenin
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 193 amino acids
SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSIMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSGRLTKSSVSFAHS
UniProt: D5MU14 IUIS: Onc k 5Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | SMTDLSPFDDNIVNK | I | 0 | 0.626 | 0.65142 |
| K | IHYLFSEVNAVK | C | 0 | 0.618 | 0.13044 |
| K | CSMVGDTLTTFNNR | K | 0 | 0.526 | 0.4189 |
| K | YPVNMPLSCYQVLAQDCTIELK | F | 0 | 0.558 | 0.06608 |
| K | DHASEQNHINVK | I | 0 | 0.561 | 0.2251 |
| K | ISDIDVDLYTEDHGVMVK | V | 0 | 0.56 | 0.11712 |
| K | VNEMEISK | D | 0 | 0.224 | 0.36392 |
| K | DNLPYTDPSGSIMIK | Q | 0 | 0.714 | 0.76364 |
| K | GEGVSLYAK | S | 0 | 0.325 | 0.75762 |
| K | SHGLQEVYFDSNSWK | I | 0 | 0.61 | 0.1934 |
| K | GQTCGLCGK | A | 0 | 0.244 | 0.30706 |
| K | SSVSFAHS | $ | 0 | 0.394 | 0.26702 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.