If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GQTCGLCGK
Peptide within the protein Onc-k-5:
SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSIMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSGRLTKSSVSFAHS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GQTCGLCGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Kryptolebias marmoratus | Mangrove rivulus | NP_001316273 |
37003 |
| Austrofundulus limnaeus | Austrofundulus limnaeus | XP_013855644 |
52670 |
| Catla catla | Catla | ACN23847 |
72446 |
| Centrolabrus exoletus | Rock cook | ACK36964 ACK36963 |
171732 |
| Clupea harengus | Atlantic herring | ACJ65208 XP_012677160 XP_012678646 |
7950 |
| Ctenolabrus rupestris | Goldsinny wrasse | ABS53014 |
171735 |
| Cyprinodon variegatus | Cyprinodon variegatus | AAG30350 XP_015234162 XP_015234161 XP_015234160 XP_015234159 XP_015234158 XP_015234157 |
28743 |
| Cyprinus carpio | Common carp | KTF79856 |
7962 |
| Danio rerio | Zebrafish | AAW56967 AAW56966 NP_001103854 XP_009296666 NP_001038378 |
7955 |
| Dicentrarchus labrax | European seabass | AFA26669 AFA26670 |
13489 |
| Fundulus heteroclitus | Mummichog | XP_012721455 Q98893 |
8078 |
| Gadus chalcogrammus | Walleye pollock | BAM22587 |
1042646 |
| Gobio gobio | Gudgeon | ACL55017 |
27704 |
| Gobiocypris rarus | Gobiocypris rarus | ABP64738 |
143606 |
| Hippoglossus hippoglossus | Atlantic halibut | ABQ58113 ABQ58114 |
8267 |
| Labrus mixtus | Cuckoo wrasse | ACK36968 ACK36967 |
508554 |
| Larimichthys crocea | Large yellow croaker | KKF29699 XP_010745362 AKK31327 XP_010745363 KKF29700 AKK31325 NP_001290497 |
215358 |
| Lepomis macrochirus | Bluegill | BAP82417 |
13106 |
| Liza aurata | Golden grey mullet | AAN05023 |
48191 |
| Melanogrammus aeglefinus | Haddock | AAK15157 |
8056 |
| Micropterus salmoides | Largemouth bass | AAD54274 |
27706 |
| Morone americana | White perch | AAZ17415 AAZ17416 |
46260 |
| Morone saxatilis | Striped sea-bass | ADZ57172 ADZ57173 |
34816 |
| Mugil soiuy | So-iuy mullet | ABR09267 |
446808 |
| Nothobranchius furzeri | Turquoise killifish | XP_015826000 |
105023 |
| Notothenia coriiceps | Black rockcod | XP_010779640 XP_010782071 |
8208 |
| Notropis hudsonius | Spottail shiner | AAR15333 |
254296 |
| Oncorhynchus clarkii | Cutthroat trout | AGQ04606 |
30962 |
| Oncorhynchus keta | Chum salmon | BAJ07603 BAH10127 BAH10126 |
8018 |
| Oncorhynchus mykiss | Rainbow trout | AAB02176 A45967 Q92093 |
8022 |
| Oncorhynchus mykiss gairdneri | Oncorhynchus mykiss gairdneri | A45967 |
857570 |
| Pagrus major | Red seabream | BAE43870 BAE43871 |
143350 |
| Perca flavescens | Yellow perch | ACO34807 |
8167 |
| Perca fluviatilis | European perch | ACL36591 |
8168 |
| Salmo salar | Atlantic salmon | AAL29923 XP_014024135 |
8030 |
| Sillago japonica | Japanese sillago | BAC20186 |
43258 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016298359 XP_016311024 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016117855 XP_016112087 |
75366 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016409767 |
307959 |
| Sparus aurata | Gilthead seabream | CDK37743 |
8175 |
| Syngnathus abaster | Black-striped pipefish | AHA91715 |
161583 |
| Takifugu rubripes | Torafugu | XP_011613233 XP_011613232 XP_011613231 XP_011613230 |
31033 |
| Thunnus thynnus | Northern bluefin tuna | CAJ28377 ACX32462 ACX32463 ADD63987 |
8237 |
| Trematomus bernacchii | Emerald rockcod | CBL95236 |
40690 |
| Verasper moseri | Barfin flounder | BAD93695 BAD93696 |
98923 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.