If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SMTDLSPFDDNIVNK
Peptide within the protein Onc-k-5:
SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSIMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSGRLTKSSVSFAHS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SMTDLSPFDDNIVNK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Oncorhynchus clarkii | Cutthroat trout | AGQ04606 |
30962 |
| Oncorhynchus keta | Chum salmon | BAJ07603 BAH10127 BAH10126 BAO57692 BAO57691 |
8018 |
| Oncorhynchus mykiss | Rainbow trout | AAB02176 A45967 Q92093 |
8022 |
| Oncorhynchus mykiss gairdneri | Oncorhynchus mykiss gairdneri | A45967 |
857570 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.