If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SSVSFAHS
Peptide within the protein Onc-k-5:
SMTDLSPFDDNIVNKIHYLFSEVNAVKCSMVGDTLTTFNNRKYPVNMPLSCYQVLAQDCTIELKFMVLLKKDHASEQNHINVKISDIDVDLYTEDHGVMVKVNEMEISKDNLPYTDPSGSIMIKQKGEGVSLYAKSHGLQEVYFDSNSWKIKVVDWMKGQTCGLCGKADGEHRQEYRTPSGRLTKSSVSFAHS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SSVSFAHS are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cyprinus carpio | Common carp | KTF96852 BAD51933 KTF79856 |
7962 |
| Danio rerio | Zebrafish | AAW56967 AAW56966 NP_001103854 XP_009296666 NP_001038378 |
7955 |
| Gobio gobio | Gudgeon | ACL55017 |
27704 |
| Gobiocypris rarus | Gobiocypris rarus | ABP64738 |
143606 |
| Oncorhynchus clarkii | Cutthroat trout | AGQ04606 |
30962 |
| Oncorhynchus keta | Chum salmon | BAJ07603 BAH10127 BAH10126 |
8018 |
| Oncorhynchus mykiss | Rainbow trout | AAB02176 A45967 Q92093 |
8022 |
| Oncorhynchus mykiss gairdneri | Oncorhynchus mykiss gairdneri | A45967 |
857570 |
| Reticulomyxa filosa | Reticulomyxa filosa | ETO36523 |
46433 |
| Salmo salar | Atlantic salmon | AAL29923 XP_014024135 |
8030 |
| Salvelinus alpinus | Arctic char | AAT11177 AAT11178 |
8036 |
| Salvelinus leucomaenis | Whitespotted char | BAM22589 |
8034 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016298359 XP_016311024 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016117855 |
75366 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016409767 XP_016377396 |
307959 |
| Ziziphus jujuba | Ziziphus jujuba | XP_015880475 |
326968 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.