Common buckwheat Protein: Fag e 2 | 2S Albumin

Cart: 0

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.

Sequence - 149 amino acids

MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIKEGVRDLKELPSKCGLSELECGSRGNRYFV

UniProt: Q2PS07 IUIS: Fag e 2

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:

Cysteine

Methionine

NXS / NXT

RP / KP

RR / KK / KR / RK

Nonspecific

Peptide Characteristics:

Minimum length:

Maximum length:

1	Peptide	2	ESP⁴	CONSeQ⁵
K	LFIILATATLLIAATQATYPR	D	0.412	0.1154
R	DEGFDLGETQMSSK	C	0.543	0.63494
K	MNEPHLK	K	0.245	0.17488
R	YIAMDILDDK	Y	0.428	0.36122
K	YAEALSR	V	0.244	0.22796
R	VEGEGCK	S	0.189	0.09134
K	SEESCMR	G	0.235	0.0975
R	GCCVAMK	E	0.223	0.28044
K	EMDDECVCEWMK	M	0.417	0.35132
K	MMVENQK	G	0.211	0.1883
K	CGLSELECGSR	G	0.468	0.45122

¹ Previous amino acid (^ = Start of protein)

² Next amino acid ($ = End of protein)

³ Exp. = Number of publications in which this peptide has been reported experimentally

⁴ ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

⁵ CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.