If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: MMVENQK
Peptide within the protein Fag-e-2:
MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIKEGVRDLKELPSKCGLSELECGSRGNRYFV
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Wheat | Fag-e-2.0101 | 3617 |
| Wheat | Fag-t-2.0101 | 62330 |
Species containing the peptide MMVENQK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Fagopyrum esculentum | Common buckwheat | AAX57578 ABC18306 AAX57578 ABC18306 |
3617 |
| Fagopyrum tataricum | Tartarian buckwheat | ADW27428 ADW27428 |
62330 |
| Parasteatoda tepidariorum | Common house spider | XP_015907784 XP_015907783 XP_015907784 XP_015907783 |
114398 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.