If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SEESCMR
Peptide within the protein Fag-e-2:
MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIKEGVRDLKELPSKCGLSELECGSRGNRYFV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SEESCMR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Daedalea quercina L-15889 | Daedalea quercina l-15889 | KZT71182 |
1314783 |
| Fagopyrum esculentum | Common buckwheat | AAX57578 BAB79444 ABC18306 |
3617 |
| Fagopyrum tataricum | Tartarian buckwheat | ABO93594 |
62330 |
| Musca domestica | House fly | XP_005176120 XP_011295023 XP_005176119 XP_005176118 |
7370 |
| Orussus abietinus | Orussus abietinus | XP_012270499 |
222816 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.