If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VEGEGCK
Peptide within the protein Fag-e-2:
MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIKEGVRDLKELPSKCGLSELECGSRGNRYFV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VEGEGCK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Fagopyrum esculentum | Common buckwheat | AAX57578 ABC18306 |
3617 |
| Nicotiana tabacum | Common tobacco | XP_016512884 |
4097 |
| Nicotiana tomentosiformis | Nicotiana tomentosiformis | XP_009607077 XP_009601286 |
4098 |
| Plasmodium falciparum | Malaria parasite p. falciparum | AJD77403 AJD77385 |
5833 |
| Plasmodium falciparum Dd2 | Plasmodium falciparum dd2 | KOB85215 |
57267 |
| Plasmodium falciparum RAJ116 | Plasmodium falciparum raj116 | KNC35023 |
580058 |
| Plasmodium reichenowi | Plasmodium reichenowi | XP_012760434 |
5854 |
| Tamarix androssowii | Tamarix androssowii | AAT39518 |
189785 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.